KEGG   Myxococcus stipitatus: MYSTI_01599Help
Entry
MYSTI_01599       CDS       T02436                                 

Definition
esterase/lipase/thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
msd  Myxococcus stipitatus
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    MYSTI_01599
Enzymes [BR:msd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MYSTI_01599
   3.1.2  Thioester hydrolases
    3.1.2.-  
     MYSTI_01599
Lipid biosynthesis proteins [BR:msd01004]
 Fatty acid synthase
  Component type
   MYSTI_01599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1979541..1980287)
Genome map
AA seq 248 aa AA seqDB search
MRAALLGLAPDVYSAELGRLRAGAKEAAHELLEDPSVGEMVDRLPLRPGARVLAFGDSLT
SDPQSWAVILSELLAVRRPADGILVDVSAVAGETTTHGLIRIGGVIARNPDWLLFFIGVN
DARTQGPAPSKTLVAPEETARNLAELRERVSRETKARCLWVTPPPVLEERVSKHWGLSRF
GVRFRNEDIARVAEAIAAFDEPVIHLFERLGLPPPPELHLEDGLHFTQEGQKRIALEVVR
GWADGRAR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctgccctgctcggcctcgctccggacgtctactccgccgagctcggacgcctg
agggccggcgcgaaggaggccgcgcacgagctgctcgaggatccctcggtgggagagatg
gtggaccgccttcccttgcggccgggggcgagggttctcgcgttcggcgacagcctcacc
tccgatccacagtcgtgggcggtgatcctgagcgagttgctggccgtgcgccgtcccgcg
gatggaatcctggtcgacgtcagcgctgtcgccggcgagacgacaacacacggcctgatt
cgaatcggcggggtcatcgcgaggaacccggactggctcttgttcttcatcggcgtgaac
gacgctcgaacccaaggcccggcgccgagcaagacgctcgtcgcgcccgaggagacggcg
cgcaacctcgcggagctccgcgagcgcgtctcccgggagacgaaggcgaggtgtctgtgg
gtcactcctccgccggtgctcgaagagcgcgtgtcgaagcactggggactgtcccgcttc
ggggttcgcttccgcaacgaggacatcgcccgtgtcgccgaggccattgccgctttcgac
gagcccgtcatccatctcttcgagaggctcggcctgccgcccccgccggagctgcacctg
gaggacgggcttcacttcacgcaggagggacagaagcgcatcgcgctcgaagtcgtgcgc
ggctgggccgacgggagggctcgatga

DBGET integrated database retrieval system