KEGG   Myxococcus stipitatus: MYSTI_01888Help
Entry
MYSTI_01888       CDS       T02436                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
msd  Myxococcus stipitatus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MYSTI_01888
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    MYSTI_01888
Enzymes [BR:msd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     MYSTI_01888
Lipid biosynthesis proteins [BR:msd01004]
 Desaturase
  First
   MYSTI_01888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2342404..2343312
Genome map
AA seq 302 aa AA seqDB search
MSKYGVQKAEPMWVIRVRLILLHLGALAVFFVPFQWELVALAAVSYFPRILGVEAGYHRY
FSHRSYKTSRVFQFLMAVLGSSSGQRGVLWWAAHHRAHHRHTDTEEDVHSPVHGFWKSHL
GWLLEEKNADTHLDHVADFACFPELRLINKYYYVPALLLLVGLGVAGAQGWLGPDINAWQ
AVAWGFFLPTVLALHSILAVNSLAHGNGRWASYRRFATRDLSLNSIWLALPSVGAGWHNN
HHRFSASSRAGFTWYEVDLSYLWLKSLAALRLVWELRPVPAEIMRQGGLLDEEKPKVDQT
MG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaatatggcgtgcagaaggccgagccgatgtgggtgattcgggttcgcctcatt
ctcttacatctcggcgctctcgccgtgttcttcgttcccttccagtgggagctcgtcgcg
ctggcggccgtcagctacttccctcgcatcctcggggtggaggcgggctatcaccgctat
ttctcacatcggtcctacaagacgagccgggtgtttcagttcttgatggcggtgctgggc
tcctcgtccgggcagcggggcgtgttgtggtgggccgcgcaccaccgggcacatcatcgg
cacacggacacggaagaggatgtgcactccccggtgcatggcttctggaagtcgcacctg
ggctggctgctcgaggagaagaacgcggacacccacctggaccatgtggctgacttcgcg
tgcttcccggagctgcggctcatcaacaagtattactacgtgcccgcgctcctgttgctc
gtggggctgggggtggcgggagcccagggatggctggggcccgatatcaatgcctggcag
gccgtggcctgggggttcttcctgcccaccgtgctggcgctccactccatcctggcggtg
aactccctggcacatggcaacgggcgctgggccagctaccggcgcttcgccacgcgagac
ttgtcgttgaacagcatctggctggcgctgcccagcgtgggcgccgggtggcacaacaat
catcatcgcttcagcgccagctcgcgcgcggggttcacctggtacgaagtggacctgagc
tatctgtggctgaaatcactcgccgccttgcggctggtctgggagctgcgccccgtcccc
gcggagatcatgcgtcagggaggactgctggacgaagagaagcccaaggtcgaccagacg
atgggctga

DBGET integrated database retrieval system