KEGG   Myxococcus stipitatus: MYSTI_02219Help
Entry
MYSTI_02219       CDS       T02436                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
msd  Myxococcus stipitatus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:msd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2814566..2815159)
Genome map
AA seq 197 aa AA seqDB search
MTPDPLNRLVAQLAKLPGIGEKTAQRLAFHILRAPGEYAAELSQAIREVKEKVHLCVRCF
SLTDTETCGFCRDHRRDERVLCVVETFADLMALERTREFKGRYHVLHGVLSPLEGVGPEQ
LRIKELLERLNDSRVEELILATNPDIEGEATALYLTRLLKPMGLRVTRIAQGLPMGGDLE
FADQATLAKALSARRDL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgactcccgatccgctgaaccgccttgtcgcccagctcgcgaagctgccgggcatcggc
gagaagaccgcccagcgcctggcgttccacatcctgcgggcgcccggcgagtacgccgcc
gagctgtcgcaggccatccgcgaggtgaaggagaaggtgcacctgtgcgtgcgctgtttc
tccctcaccgacacggagacgtgtggcttctgccgggaccaccgccgcgatgagcgtgtg
ctgtgcgtggtggagaccttcgccgacctgatggcgctggagcggacgcgcgagttcaag
ggtcgctaccacgtcctgcacggcgtgctgtcgccgctggagggcgtgggcccggagcag
cttcgcatcaaggagctgctcgagcgcctcaacgacagccgggtggaggagctcatcctc
gccaccaacccggacatcgagggcgaggccaccgcgctctacctgacgcgcctgctcaag
cccatggggctgcgtgtcacgcgcatcgcccagggcctgcccatgggcggggacctggag
ttcgcggaccaggccaccctcgcgaaggcgctgtccgcccgccgcgacctctga

DBGET integrated database retrieval system