KEGG   Myxococcus stipitatus: MYSTI_02614Help
Entry
MYSTI_02614       CDS       T02436                                 

Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
msd  Myxococcus stipitatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:msd00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3289990..3291432
Genome map
AA seq 480 aa AA seqDB search
MRWNQQGRWLPVVLAASVWSACGPASPPAPEPDSQGVVSAGLAELVVNGDFSGGSVAPWW
SGPNTQSVVENGRLRVNVTGNPANPWDAPMGQDGIALVNGQSYTLAFTASASAPVTVRVT
AQLGTAPYTAPLDQRITLDGTPRAFSFPFTSNLGTTAGQVTFQLGGAGAFSAFLDNVSLS
TGGGGGGGPLGMTSGFYVDPDSNPAVWVRNNGWDSRAAGIQSAIASKAGAKWFGNWSGDI
ASAVSSYVTAADAADKLPVLVAYNIPGRDCGSHSGGGAGSPEAYRTWISAFVTGLGNRPA
VVIIEPDAVAQLDCLPDDTERNTRLGLLRYATEQLRDRAPNTWAYLDGGNAGWIAADTMA
QRLESAGARNIRGFALNVSNYYLTSASTAYGAAVNSALNTRYAYTRPFVVDTSRNGNGHN
GDWCNPAGRKLGALSQAGGGAEMLLWVKVPGDSDGNCGIAPNTPAGTFSPDIATRLISGT
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcgatggaatcaacaggggcgctggctccccgtggtgctggcggcgtccgtctggagt
gcctgtggcccggcgtcaccgcccgcgcccgaaccggactcgcaaggcgtggtctccgcg
gggctcgccgagctcgtcgtgaacggcgacttcagcggaggctcggtggcgccctggtgg
agcggccccaacacgcagtcggtggtggagaacgggcggctgcgggtcaacgtcacgggc
aacccggcgaatccgtgggatgcgcccatgggacaggatggcatcgccctggtgaacggt
cagtcgtacaccttggcgttcaccgcgtcggcctccgcgcccgtgacggtgcgggtgacg
gcgcagctggggacggcgccgtacaccgcgccgttggaccagcgcatcaccttggatggc
acgccgcgcgcgttctcgttccccttcacctcgaacctgggcacgacggccgggcaggtg
accttccaactgggcggcgcgggggccttctccgcgttcctggacaacgtctcgctctcc
acgggcggtggaggtggtggtgggccgctggggatgaccagcggcttctacgtggacccg
gactccaaccccgccgtgtgggtgcgcaacaacggctgggactcgcgcgcggcgggcatc
cagagcgccatcgcgagcaaggcgggggcgaagtggttcggcaactggagcggagacatc
gcgtcggcggtctccagctacgtcaccgcggcggacgcggcggacaagctgccggtgctc
gtggcctacaacatccctgggcgcgactgtggcagccactcagggggcggcgcgggcagc
ccggaggcgtaccggacgtggatctccgcgttcgtcaccggcctgggcaaccgcccggcc
gtggtcatcatcgagcccgacgcggtggcgcagctcgactgcctccccgatgacacggag
cgcaacacgcggctgggcctcttgcggtacgcgacggagcagctgcgagatcgcgcgccc
aacacctgggcctacctggatggcggcaacgcgggctggattgccgccgacaccatggcg
cagcggctggagtccgcgggcgcgcgcaacatccgaggcttcgccctcaacgtgtcgaac
tattacctcacgagcgcctccacggcgtacggcgcggcggtcaacagcgcgctgaacacg
cgctatgcgtacacgcgtcccttcgtggtggacaccagccgcaacggcaacggccacaac
ggcgactggtgcaaccccgcgggccgcaagctgggcgcgttgtcacaagcaggtggaggc
gcggagatgctcctgtgggtgaaggtgcctggggactccgacggaaactgcggcatcgcg
ccgaacacgcccgcgggcacgttcagtcccgacatcgccacgcgcctcatctcgggtacg
tga

DBGET integrated database retrieval system