KEGG   Myxococcus stipitatus: MYSTI_02636Help
Entry
MYSTI_02636       CDS       T02436                                 

Definition
(GenBank) arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
msd  Myxococcus stipitatus
Pathway
msd00220  Arginine biosynthesis
msd00330  Arginine and proline metabolism
msd01100  Metabolic pathways
msd01110  Biosynthesis of secondary metabolites
msd01130  Biosynthesis of antibiotics
msd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    MYSTI_02636
   00330 Arginine and proline metabolism
    MYSTI_02636
Enzymes [BR:msd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     MYSTI_02636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AGC43952
UniProt: L7U8T5
Position
complement(3319014..3319943)
Genome map
AA seq 309 aa AA seqDB search
MPSPIALVAAPSSLGLSRPEGRVPRVDLLPEALMDAGLGSRLGARVEHTVLPGPYEPERD
AELRVRNPRGIVAMSRELADVVERVVRAKRFPLVLGGDCSILLGCLLGLKRTGGRHGLAF
MDGHTDFWPPEASLSGGVAGMDLWFASGRGPSLLSNLEGRGPLVRDEDVAVLGVRDPEHW
GAKVSAEHVRDTAMAWLDLSTLRRDGIAAGVTRAVERFRATGVDGFWMHLDADVMDDAVM
PAVDSRQPDGLRVDELGELVARLVESGMAVGMDVTIYDPSLDPERHAARALVDTLVRGLG
ALVPASETR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgccctcgcccatcgccctggtcgccgcgccatcgagtctgggactcagtcgcccggag
ggacgggttccccgcgtggacctcctcccggaggcgctcatggatgcggggctcgggagt
cggctcggggctcgggtggagcacacggtgttgcccgggccgtatgagccggagcgggac
gcggagcttcgggtccgcaacccgcgaggcatcgtggcgatgagccgcgaactcgcggac
gtggtggagcgcgtcgtgcgggcgaagcgcttcccgctggtgctcgggggtgattgcagc
atcttgctggggtgtctgctggggctgaagcgcacgggtggccgccacgggctggccttc
atggatgggcacaccgacttctggccaccggaagcgtctttgtccggaggtgtcgcgggg
atggacttgtggttcgcctcgggccgaggcccttcgctcctgtcgaacctggaagggcga
ggccccttggtccgcgacgaggacgtggccgtgttgggagtcagggacccggagcattgg
ggtgcgaaggtctccgctgagcacgttcgtgacacggcgatggcgtggttggacttgagc
acgctgcgcagggatggcatcgcggcgggggtgacgcgggccgtcgagcgcttccgggcc
acgggggtcgatgggttctggatgcatctggacgcggacgtgatggacgacgcggtgatg
ccggctgtggactcgcgtcagccggatgggctgcgcgtggacgagctgggcgagttggtg
gcgcggctcgtggagtcagggatggcggtggggatggacgtcaccatctacgacccgagc
ctggacccggagcgacatgcggcgcgggcgttggtggacacgctggtccgcggattgggg
gcgctggtgcccgcgagtgagacgcgatag

DBGET integrated database retrieval system