KEGG   Myxococcus stipitatus: MYSTI_03053Help
Entry
MYSTI_03053       CDS       T02436                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
msd  Myxococcus stipitatus
Pathway
msd00860  Porphyrin and chlorophyll metabolism
msd01100  Metabolic pathways
msd01110  Biosynthesis of secondary metabolites
msd01120  Microbial metabolism in diverse environments
Module
msd_M00121  Heme biosynthesis, glutamate => heme
msd_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MYSTI_03053
Enzymes [BR:msd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MYSTI_03053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 MEDS ANF_receptor
Motif
Other DBs
NCBI-ProteinID: AGC44369
UniProt: L7UD27
Position
3868814..3869542
Genome map
AA seq 242 aa AA seqDB search
MTRPRERAEELCFLLEDEGAEVLSLPLLELRPPEDPRPLASAAEHIQRYRWVVFASPSGV
DALMDALREAGTMSRLDRVRLAAVGPRTARAVKGYGLEVAAEPEEGTGLALFELIKDSLQ
SGDEVLLPAAEEGRRELEDSLRDAGLLVTRVTAYRSLPAELPPEALEQLGTSPLDVVVFA
SPRTVEAFLEAAGRERLGTAKVVAIGPTTASALEQLGLPASAVAERPTPESLVDATVRAV
RG
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcgcccgcgtgagcgggccgaggagctgtgcttcctgctggaggacgagggcgcg
gaggtgctcagcctcccgctcctggagctgcgtccgccggaggacccgcgtcctttggcg
tccgcggccgagcacatccagcgttaccggtgggtggtgttcgccagtccgtcgggggtg
gatgccctgatggacgccttgcgcgaggcggggacgatgtcccggttggaccgcgtgagg
ctggcggcggtggggcctcggacggcgcgcgcggtgaaggggtatggcctggaggtcgcc
gccgagcccgaggagggcacgggcctggcgctcttcgagctcatcaaggacagcctccag
tcgggcgacgaggtgctgctgcccgcggcggaagagggccggcgggagctcgaggactcg
ctgcgggacgcggggctgctcgtcacgcgtgtgacggcctaccgctccctgcccgcggag
ctgcctcccgaggccctggagcagctgggcacctccccgctggacgtggtggtgttcgcc
tcgcctcgcaccgtggaggccttcctggaggccgcggggcgtgagcggctggggacggcg
aaggtggtggccattggccccacgacggcgtccgccctggagcagctcgggttgccggcc
tcggccgtcgccgagcggcccacgccggagtcgctcgtggacgccacggtccgcgccgtg
cgtggttag

DBGET integrated database retrieval system