KEGG   Myxococcus stipitatus: MYSTI_03069Help
Entry
MYSTI_03069       CDS       T02436                                 

Definition
(GenBank) pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
msd  Myxococcus stipitatus
Pathway
msd00010  Glycolysis / Gluconeogenesis
msd00020  Citrate cycle (TCA cycle)
msd00620  Pyruvate metabolism
msd01100  Metabolic pathways
msd01110  Biosynthesis of secondary metabolites
msd01120  Microbial metabolism in diverse environments
msd01130  Biosynthesis of antibiotics
msd01200  Carbon metabolism
Module
msd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYSTI_03069
   00020 Citrate cycle (TCA cycle)
    MYSTI_03069
   00620 Pyruvate metabolism
    MYSTI_03069
Enzymes [BR:msd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MYSTI_03069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 PYNP_C RnfC_N
Motif
Other DBs
NCBI-ProteinID: AGC44385
UniProt: L7U950
Position
3892303..3893901
Genome map
AA seq 532 aa AA seqDB search
MAIPIQMPSLSPTMTEGKIVKWLKKVGDKVSSGEALAEVETDKSNLEIEAYDDGYVLQIL
VEANQTAAVGAPIAYIGKQGEKVAGGGAAPAPQAAAAPAPAPKVEAPAPVAAPAASGGGR
IAIQMPSLSPTMTEGKIVKWLKKVGDKVSSGEALAEVETDKSNLEIEAYDDGTLAEIVVG
ANQSAPVGSPIAYIAAKGGKAAAAAAAPAPVARPAEVAAAPKPQATPAPAPVAPAQAEGR
RVRASPLAKKIARDRGVDITRVQGSGPSGRVVKRDIEEALARGVTAPAPSAPTAPVARKA
PAAVAARAESRTEPLTSMRKVIAQRMTEVKPGVPHFYLTIEVEMDAAVKVREEAKALDLK
VSVNDLVVKAVAMAVKRYPKINVSLQGDQVVHHGSVDVGVAVALEQGLITPVVRDADQKG
LQAISTEVRELAERARKRALKPDEYTGGSITVSNLGMYGIDQFVAIINPPQASILAVGAV
SDKVVVRDGQMVIRKMMTATLSCDHRIIDGAIGAEFMRELRGLLEHPTRLLF
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggccattcccattcagatgccgagcctctccccgacgatgacggaggggaagatcgtc
aagtggctgaagaaggtgggggacaaggtctcctccggtgaggcgctcgccgaggtggag
acggacaagtccaacctcgagatcgaggcctacgacgacggctacgtgctgcagatcctc
gtcgaggcgaaccagacggcggctgtcggcgcgcccatcgcgtacatcggcaagcaggga
gagaaggtcgcgggtggtggcgcggccccggctccccaggcggctgctgccccggcgccc
gcgccgaaggtggaggctcctgctccggtcgccgctcccgcggcttcggggggcggccgc
atcgccatccagatgccgagcctctccccgacgatgacggaggggaagatcgtcaagtgg
ctgaagaaggtgggggacaaggtctcctccggtgaggcgctcgccgaggtggagacggac
aagtccaacctcgagatcgaggcctacgacgacggcacgctggcggagatcgtcgtgggc
gcgaaccagtcggcgcccgtcggttcccccatcgcgtacatcgcggcgaaggggggcaag
gcggcggctgctgccgcggctcccgctcccgtggccaggcccgcggaagtggcggcggcg
cccaagccccaggccacgcccgctccggctccggtggccccggcgcaggcggagggccgc
cgggtgcgcgccagtccgctcgcgaagaagatcgcccgcgaccgtggcgtggacatcacg
cgcgtgcagggctcgggtccgtcgggtcgcgtggtgaagcgcgacatcgaagaggccctg
gctcggggcgtgacggctccggctccctcggcgcccacggctccggtggcgcgcaaggct
ccggccgcggtggctgcacgcgccgagtctcggaccgagccgctgacgtccatgcgcaag
gtgattgcgcagcggatgacggaggtgaagcccggcgtgccgcacttctatctcaccatc
gaggtggagatggacgcggccgtgaaggtgcgcgaggaggcgaaggcgctggacctcaag
gtctccgtcaacgacctcgtcgtgaaggccgtggcgatggcggtgaagcgctatccgaaa
atcaacgtctcgctccagggggaccaggtggtccaccatggctcggtggacgtcggtgtg
gcggtcgcgttggagcaggggctcatcacgcccgtggttcgggacgcggaccagaagggg
ctccaggccatctccacggaggtgcgtgagttggccgagcgtgcccgcaagcgcgccctc
aagcccgacgagtacacgggcggctccatcaccgtgagcaacctgggcatgtacggcatc
gaccagttcgtcgccatcatcaacccgccgcaggcgtccatcctcgcggtgggcgcggtg
agcgacaaggtggtggtgcgcgacgggcagatggtgattcgcaagatgatgacggcgacg
ttgtcgtgcgaccaccgcatcatcgacggtgccatcggcgccgagttcatgcgggagctg
cgcggcctcttggagcaccccacgcggctgctcttctag

DBGET integrated database retrieval system