KEGG   Myxococcus stipitatus: MYSTI_03069Help
Entry
MYSTI_03069       CDS       T02436                                 

Definition
pyruvate dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
msd  Myxococcus stipitatus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYSTI_03069
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MYSTI_03069
   00020 Citrate cycle (TCA cycle)
    MYSTI_03069
   00620 Pyruvate metabolism
    MYSTI_03069
Enzymes [BR:msd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MYSTI_03069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3892303..3893901
Genome map
AA seq 532 aa AA seqDB search
MAIPIQMPSLSPTMTEGKIVKWLKKVGDKVSSGEALAEVETDKSNLEIEAYDDGYVLQIL
VEANQTAAVGAPIAYIGKQGEKVAGGGAAPAPQAAAAPAPAPKVEAPAPVAAPAASGGGR
IAIQMPSLSPTMTEGKIVKWLKKVGDKVSSGEALAEVETDKSNLEIEAYDDGTLAEIVVG
ANQSAPVGSPIAYIAAKGGKAAAAAAAPAPVARPAEVAAAPKPQATPAPAPVAPAQAEGR
RVRASPLAKKIARDRGVDITRVQGSGPSGRVVKRDIEEALARGVTAPAPSAPTAPVARKA
PAAVAARAESRTEPLTSMRKVIAQRMTEVKPGVPHFYLTIEVEMDAAVKVREEAKALDLK
VSVNDLVVKAVAMAVKRYPKINVSLQGDQVVHHGSVDVGVAVALEQGLITPVVRDADQKG
LQAISTEVRELAERARKRALKPDEYTGGSITVSNLGMYGIDQFVAIINPPQASILAVGAV
SDKVVVRDGQMVIRKMMTATLSCDHRIIDGAIGAEFMRELRGLLEHPTRLLF
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggccattcccattcagatgccgagcctctccccgacgatgacggaggggaagatcgtc
aagtggctgaagaaggtgggggacaaggtctcctccggtgaggcgctcgccgaggtggag
acggacaagtccaacctcgagatcgaggcctacgacgacggctacgtgctgcagatcctc
gtcgaggcgaaccagacggcggctgtcggcgcgcccatcgcgtacatcggcaagcaggga
gagaaggtcgcgggtggtggcgcggccccggctccccaggcggctgctgccccggcgccc
gcgccgaaggtggaggctcctgctccggtcgccgctcccgcggcttcggggggcggccgc
atcgccatccagatgccgagcctctccccgacgatgacggaggggaagatcgtcaagtgg
ctgaagaaggtgggggacaaggtctcctccggtgaggcgctcgccgaggtggagacggac
aagtccaacctcgagatcgaggcctacgacgacggcacgctggcggagatcgtcgtgggc
gcgaaccagtcggcgcccgtcggttcccccatcgcgtacatcgcggcgaaggggggcaag
gcggcggctgctgccgcggctcccgctcccgtggccaggcccgcggaagtggcggcggcg
cccaagccccaggccacgcccgctccggctccggtggccccggcgcaggcggagggccgc
cgggtgcgcgccagtccgctcgcgaagaagatcgcccgcgaccgtggcgtggacatcacg
cgcgtgcagggctcgggtccgtcgggtcgcgtggtgaagcgcgacatcgaagaggccctg
gctcggggcgtgacggctccggctccctcggcgcccacggctccggtggcgcgcaaggct
ccggccgcggtggctgcacgcgccgagtctcggaccgagccgctgacgtccatgcgcaag
gtgattgcgcagcggatgacggaggtgaagcccggcgtgccgcacttctatctcaccatc
gaggtggagatggacgcggccgtgaaggtgcgcgaggaggcgaaggcgctggacctcaag
gtctccgtcaacgacctcgtcgtgaaggccgtggcgatggcggtgaagcgctatccgaaa
atcaacgtctcgctccagggggaccaggtggtccaccatggctcggtggacgtcggtgtg
gcggtcgcgttggagcaggggctcatcacgcccgtggttcgggacgcggaccagaagggg
ctccaggccatctccacggaggtgcgtgagttggccgagcgtgcccgcaagcgcgccctc
aagcccgacgagtacacgggcggctccatcaccgtgagcaacctgggcatgtacggcatc
gaccagttcgtcgccatcatcaacccgccgcaggcgtccatcctcgcggtgggcgcggtg
agcgacaaggtggtggtgcgcgacgggcagatggtgattcgcaagatgatgacggcgacg
ttgtcgtgcgaccaccgcatcatcgacggtgccatcggcgccgagttcatgcgggagctg
cgcggcctcttggagcaccccacgcggctgctcttctag

DBGET integrated database retrieval system