KEGG   Myxococcus stipitatus: MYSTI_03104Help
Entry
MYSTI_03104       CDS       T02436                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
msd  Myxococcus stipitatus
Pathway
msd00071  Fatty acid degradation
msd00280  Valine, leucine and isoleucine degradation
msd00281  Geraniol degradation
msd00310  Lysine degradation
msd00360  Phenylalanine metabolism
msd00362  Benzoate degradation
msd00380  Tryptophan metabolism
msd00410  beta-Alanine metabolism
msd00627  Aminobenzoate degradation
msd00640  Propanoate metabolism
msd00650  Butanoate metabolism
msd00903  Limonene and pinene degradation
msd00930  Caprolactam degradation
msd01100  Metabolic pathways
msd01110  Biosynthesis of secondary metabolites
msd01120  Microbial metabolism in diverse environments
msd01130  Biosynthesis of antibiotics
msd01212  Fatty acid metabolism
Module
msd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MYSTI_03104
   00650 Butanoate metabolism
    MYSTI_03104
  Lipid metabolism
   00071 Fatty acid degradation
    MYSTI_03104
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MYSTI_03104
   00310 Lysine degradation
    MYSTI_03104
   00360 Phenylalanine metabolism
    MYSTI_03104
   00380 Tryptophan metabolism
    MYSTI_03104
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MYSTI_03104
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MYSTI_03104
   00281 Geraniol degradation
    MYSTI_03104
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MYSTI_03104
   00627 Aminobenzoate degradation
    MYSTI_03104
   00930 Caprolactam degradation
    MYSTI_03104
Enzymes [BR:msd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MYSTI_03104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: AGC44418
UniProt: L7U8M5
Position
3930765..3931847
Genome map
AA seq 360 aa AA seqDB search
MSDGVWMEMRGSVGVLTLNRPKALNALNLEMCRALLPQLDAWAADPAVKAVVIRGAGGRA
FCAGGDVRAVAASLTEAPPPGQERLSREFFRAEYALNHRIHHLGKPYVSLVDGICMGGGL
GLSIHGAYRVVTEKLVLAMPETALGLFPDVGGGWFLPRFPGESGTYLGLTGARCSAADAM
WLGYGTHHVESARVDALLEAIIGAEWGRGSASAVVEEVLARFHADAGTSALATQHASMDR
CFAAERVEDIQQALELEGTPWAQETWATLLRMCPMSLKVSLRQLRMGRGRSYDEMVGLEY
RLSQALTAREDFREGIRAVLVDKDGKARWHPGTLGDVKDSDVEACFAPRAGDELVLSPPK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatggcgtgtggatggagatgcgtgggtcggtgggcgtgctgacgctgaaccgc
ccgaaggcgttgaacgcgctgaacctggagatgtgccgggcgctgcttccccagctcgac
gcctgggcggcggacccagcggtcaaggccgtggtcatccggggcgcgggcggccgagcc
ttctgcgcgggaggggacgtgcgcgcggtggcggcctccctgacggaggcgcctccgccg
ggacaggagcgcctgtcgcgtgagttcttccgcgccgagtacgcgctgaaccatcgcatc
caccacctgggcaagccgtacgtgtcgctcgtggacggcatctgcatgggtgggggcttg
gggctctccatccacggtgcgtaccgcgtcgtcacggagaagctggtgctggcgatgccg
gagacggcgctggggctcttcccggatgtgggaggaggctggttcctgccgcgcttcccg
ggcgagtcggggacgtacctgggcctgacgggcgcgcgatgcagcgcggcggacgcgatg
tggctgggctacgggacgcaccacgtggagtcggcgcgagtggacgcgctgctggaggcg
atcatcggcgcggagtggggaaggggttcggcgagcgcggtggtggaagaggtgctcgcg
cgcttccacgcggatgcgggaacgtccgcgctggccacgcagcacgcctcgatggaccgg
tgcttcgcggcggagcgggtggaggacatccagcaggcgctggagctggagggcacgccc
tgggctcaggagacgtgggccacgctgctgcgcatgtgtccgatgagcttgaaggtgtcg
ctgcggcagctgcgcatgggacgcggccggagctacgacgagatggtgggcctcgagtac
cggctgagccaggcactgactgctcgcgaggacttccgcgagggaatccgcgcggtgctg
gtggacaaggacggcaaggcacgctggcatccgggaacgctgggcgacgtcaaggactcg
gacgtggaggcgtgcttcgcgccacgggctggagacgagctcgtcctgtcgccgccgaag
tga

DBGET integrated database retrieval system