KEGG   Myxococcus stipitatus: MYSTI_03696Help
Entry
MYSTI_03696       CDS       T02436                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
msd  Myxococcus stipitatus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MYSTI_03696
Enzymes [BR:msd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MYSTI_03696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4687768..4688733
Genome map
AA seq 321 aa AA seqDB search
MAPRRQADIVVVGGISTDFRVQGARLPRPGERVEGYSFQEQLGGKGAHGAVAVARLGARS
TLVGRVGMDVRGMALLEQLEEEGVETRAVARDPAESTGVLMEMVDEAGRAQCLSVAGANR
RLCVRDVLAAEERITRADVLLAQLGVPLDAVVAAVHIARAAGSHIVLAPRSATSLPEELL
EAVHVVCLGGAEAAVLTGLDVGDLDSARQAAENLVRRGAGAAVIAAPQGHLLLGKEGELW
LQNLPVDWVDTAGAREAFAAAVSVALGEKRSLADAVRFAHATSALTAMRLGAMSGLPDRD
DVEAFVARLEGQALLSPHASW
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggctccgcggcggcaggccgacatcgtcgtggtcggtggaatcagcacggacttccgg
gtccagggggctcggctcccgaggcctggtgagcgcgtggaggggtactcgttccaggag
cagctgggcgggaagggggctcacggcgccgtggcggtggcgcggctgggggctcgctcg
acgctggtggggcgcgtggggatggatgttcgcggcatggcgctcctggagcagctcgag
gaggagggcgtggagacgcgcgccgtcgcgcgggaccccgccgagagcaccggtgtgttg
atggagatggtggatgaggcgggccgggcgcagtgcctgtccgtggcgggggccaatcgg
cgcctgtgcgtgcgggacgtgctcgccgccgaggagcgcatcactcgcgcggatgtgctc
ctcgcgcagctgggtgtccccctggacgcggtcgtcgccgctgtccacatcgcacgcgcc
gcgggctcgcacatcgtcctggctcccaggtccgccacctcgctcccggaggagttgctg
gaggcggtccatgtcgtgtgcctgggaggcgcggaggccgcggtgctgacggggctggac
gtgggggacctcgactccgctcggcaggccgcggagaacctggtgcgccgaggtgccggg
gccgccgtcatcgcggctccgcaagggcacctgctcctgggaaaggagggagagctgtgg
cttcagaacctgcccgtggattgggtggacacggccggtgctcgcgaggccttcgccgcg
gcggtgtccgtggccttgggagagaagcgctcactcgcggatgcggtgcgcttcgctcac
gcgacgtcggcgctgaccgcgatgcggctcggcgcgatgtcgggacttccggaccgcgat
gacgtggaggccttcgtggcccggctggaggggcaggccttgttgtcgcctcacgcgtcg
tggtga

DBGET integrated database retrieval system