KEGG   Myxococcus stipitatus: MYSTI_03721Help
Entry
MYSTI_03721       CDS       T02436                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
msd  Myxococcus stipitatus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MYSTI_03721
  Amino acid metabolism
   00340 Histidine metabolism
    MYSTI_03721
Enzymes [BR:msd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     MYSTI_03721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4718749..4720056
Genome map
AA seq 435 aa AA seqDB search
MAPLPSFLRFQGPLARLSPEDRRWLLLRGGAVDSRIAARVRELIASVQLDGDSALFEMAR
RFDGVSLSSLEVPRARCEEALAALEPSLVRALTRAVRNIARAHEVQRPRAVEVETEPGVL
VGRRPDPLGRVGVYAPGGRAVYPSSVLMGVVPAKVAGVGEVIVCSPPGRDGLPHASVLAA
AVLAGADRVFALGGAGAVAAMAYGTRSVPRVDRIVGPGNAYVAEAKLQVVGAVAIEAPAG
PSEILVVADATASPEAVAREVLAQAEHDPDAACVVVALGDAVAEAIAAQVRALSVSAKRR
EIVDAALGSRGAVLSVASLEEVWPFVADFAPEHLLLATAEPAADLERVRNAGTVFLGERS
SVAYGDYMTGSNHVLPTAGLARAYSGLNLLDFYRWTTFQRVERAASAALADDVGVLADSE
GLFAHAEAARAWRGA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggctccgcttccttcgttcctccggttccaagggcccctcgcgaggctgtcgcccgag
gaccggcgctggttgttgctgcgaggtggcgcggtcgactcgcgcatcgccgcccgggtt
cgagagctcatcgcgagtgtccaactggatggggacagcgcgctcttcgagatggcgcgc
cggttcgatggggtgtcgttgtcctcgctggaggtgcctcgggcgcgctgtgaggaggcg
ctggcggcgctggagccctccctggtgcgggcgttgacgcgggccgtgcgcaacatcgct
cgggcgcacgaggtgcagcgtcctcgcgcggtggaggtggagacggagccgggagtgttg
gtggggcgcaggccggacccactcgggcgggttggcgtgtatgcgccaggaggccgcgcg
gtctatcccagcagcgtgttgatgggcgtggtccccgcgaaggtggcgggagtgggggag
gtcatcgtgtgctcaccgccgggacgcgacggactgcctcacgcgagtgtactggccgcc
gcggtgctggcgggagcggaccgggtcttcgcgttgggaggcgcgggcgcggtggcggcg
atggcgtacgggacacggagcgtgccgcgtgtggaccgcatcgtcgggcctgggaatgcg
tacgtcgccgaagccaagcttcaggtggtgggcgcggtggccatcgaagcgcccgcgggg
ccgagtgaaatcctcgtcgtcgccgacgcgacggcgagtccggaggcggtggcgcgagaa
gtcctcgcacaagcggagcatgacccggacgcggcctgtgtcgtggtggccttgggtgac
gccgtcgcggaggccatcgcggcgcaggtacgggcgctgtcggtgagcgcgaagcggcgg
gagattgtcgacgcggcgttgggctcgcgaggcgcggtgttgagcgtggcctcgctggag
gaggtgtggcccttcgtggcggacttcgcaccggagcacctgctcctcgccacggcggag
ccggcggcggacctggagcgcgtgcgcaatgccggcaccgtcttcctgggggagcgctcg
tcggtggcgtacggcgactacatgacgggctcgaaccatgtgctgcccacggcggggctg
gcgcgggcgtactcggggctcaacctgctcgacttctaccgatggaccaccttccagcgc
gtggagcgtgccgcgtcggcggcgctggcggacgacgtgggggtgctcgcggacagtgaa
ggactcttcgcgcacgccgaggccgcgcgggcctggaggggcgcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system