KEGG   Myxococcus stipitatus: MYSTI_03721Help
Entry
MYSTI_03721       CDS       T02436                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
msd  Myxococcus stipitatus
Pathway
msd00340  Histidine metabolism
msd01100  Metabolic pathways
msd01110  Biosynthesis of secondary metabolites
msd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    MYSTI_03721
Enzymes [BR:msd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     MYSTI_03721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AGC45027
UniProt: L7UBS1
Position
4718749..4720056
Genome map
AA seq 435 aa AA seqDB search
MAPLPSFLRFQGPLARLSPEDRRWLLLRGGAVDSRIAARVRELIASVQLDGDSALFEMAR
RFDGVSLSSLEVPRARCEEALAALEPSLVRALTRAVRNIARAHEVQRPRAVEVETEPGVL
VGRRPDPLGRVGVYAPGGRAVYPSSVLMGVVPAKVAGVGEVIVCSPPGRDGLPHASVLAA
AVLAGADRVFALGGAGAVAAMAYGTRSVPRVDRIVGPGNAYVAEAKLQVVGAVAIEAPAG
PSEILVVADATASPEAVAREVLAQAEHDPDAACVVVALGDAVAEAIAAQVRALSVSAKRR
EIVDAALGSRGAVLSVASLEEVWPFVADFAPEHLLLATAEPAADLERVRNAGTVFLGERS
SVAYGDYMTGSNHVLPTAGLARAYSGLNLLDFYRWTTFQRVERAASAALADDVGVLADSE
GLFAHAEAARAWRGA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggctccgcttccttcgttcctccggttccaagggcccctcgcgaggctgtcgcccgag
gaccggcgctggttgttgctgcgaggtggcgcggtcgactcgcgcatcgccgcccgggtt
cgagagctcatcgcgagtgtccaactggatggggacagcgcgctcttcgagatggcgcgc
cggttcgatggggtgtcgttgtcctcgctggaggtgcctcgggcgcgctgtgaggaggcg
ctggcggcgctggagccctccctggtgcgggcgttgacgcgggccgtgcgcaacatcgct
cgggcgcacgaggtgcagcgtcctcgcgcggtggaggtggagacggagccgggagtgttg
gtggggcgcaggccggacccactcgggcgggttggcgtgtatgcgccaggaggccgcgcg
gtctatcccagcagcgtgttgatgggcgtggtccccgcgaaggtggcgggagtgggggag
gtcatcgtgtgctcaccgccgggacgcgacggactgcctcacgcgagtgtactggccgcc
gcggtgctggcgggagcggaccgggtcttcgcgttgggaggcgcgggcgcggtggcggcg
atggcgtacgggacacggagcgtgccgcgtgtggaccgcatcgtcgggcctgggaatgcg
tacgtcgccgaagccaagcttcaggtggtgggcgcggtggccatcgaagcgcccgcgggg
ccgagtgaaatcctcgtcgtcgccgacgcgacggcgagtccggaggcggtggcgcgagaa
gtcctcgcacaagcggagcatgacccggacgcggcctgtgtcgtggtggccttgggtgac
gccgtcgcggaggccatcgcggcgcaggtacgggcgctgtcggtgagcgcgaagcggcgg
gagattgtcgacgcggcgttgggctcgcgaggcgcggtgttgagcgtggcctcgctggag
gaggtgtggcccttcgtggcggacttcgcaccggagcacctgctcctcgccacggcggag
ccggcggcggacctggagcgcgtgcgcaatgccggcaccgtcttcctgggggagcgctcg
tcggtggcgtacggcgactacatgacgggctcgaaccatgtgctgcccacggcggggctg
gcgcgggcgtactcggggctcaacctgctcgacttctaccgatggaccaccttccagcgc
gtggagcgtgccgcgtcggcggcgctggcggacgacgtgggggtgctcgcggacagtgaa
ggactcttcgcgcacgccgaggccgcgcgggcctggaggggcgcatga

DBGET integrated database retrieval system