KEGG   Myxococcus stipitatus: MYSTI_04126Help
Entry
MYSTI_04126       CDS       T02436                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
msd  Myxococcus stipitatus
Pathway
msd00071  Fatty acid degradation
msd00072  Synthesis and degradation of ketone bodies
msd00280  Valine, leucine and isoleucine degradation
msd00310  Lysine degradation
msd00362  Benzoate degradation
msd00380  Tryptophan metabolism
msd00620  Pyruvate metabolism
msd00630  Glyoxylate and dicarboxylate metabolism
msd00640  Propanoate metabolism
msd00650  Butanoate metabolism
msd00900  Terpenoid backbone biosynthesis
msd01100  Metabolic pathways
msd01110  Biosynthesis of secondary metabolites
msd01120  Microbial metabolism in diverse environments
msd01130  Biosynthesis of antibiotics
msd01200  Carbon metabolism
msd01212  Fatty acid metabolism
msd02020  Two-component system
Module
msd_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MYSTI_04126
   00630 Glyoxylate and dicarboxylate metabolism
    MYSTI_04126
   00640 Propanoate metabolism
    MYSTI_04126
   00650 Butanoate metabolism
    MYSTI_04126
  Lipid metabolism
   00071 Fatty acid degradation
    MYSTI_04126
   00072 Synthesis and degradation of ketone bodies
    MYSTI_04126
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MYSTI_04126
   00310 Lysine degradation
    MYSTI_04126
   00380 Tryptophan metabolism
    MYSTI_04126
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MYSTI_04126
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MYSTI_04126
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MYSTI_04126
Enzymes [BR:msd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MYSTI_04126
Exosome [BR:msd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MYSTI_04126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: AGC45426
UniProt: L7U947
Position
5261735..5262916
Genome map
AA seq 393 aa AA seqDB search
MARDVVIVGAARTPIGAFQGALSKLTAPQLGAVAIKAALERAGVKPEAVQEVIMGNVLQA
GVGQAPARQATLFAGLPEGVPATTLNKVCGSGLKAVIAGAQAIALGEADVVVVGGMESMS
NAPYISHTMRGGARMGNVEFKDAMIHDGLWDVYGNVHMGNCAEECATSQNISRAQQDEFA
LESTRRAIQSQKEGLFAAEIVPVVIPGKKPGEETTVSEDEGPRNAKPDKIPGLKPVFKKD
GTVTAANASSINDGAAALVLMSEERAKAEGKTILGRITGYAQAARKPVEFTIAPADAINT
LLTKKGVKAADVDLWEINEAFAVVAIANNRLLGLDPAKVNVRGGGVVLGHPIGASGARVL
VTLLQTMKDQGKKRGVASLCIGGGEGIALMVER
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtgacgtcgtcatcgtgggcgcggcccgtacccccatcggcgccttccagggg
gcgctctccaagctgacggctccgcagctgggcgcggtggccatcaaggccgcgctggag
cgcgcgggcgtgaagcccgaggccgtgcaggaagtcatcatgggcaacgtgctccaggcc
ggtgtcggccaggcgcccgcccgtcaggccacgctgttcgccggcctgcccgagggagtt
cccgccaccacgctcaacaaggtctgtggctccggcctcaaggccgtcatcgcgggcgcg
caggcgattgccctgggcgaggcggacgtcgtcgtcgtgggcggcatggagtccatgagc
aacgcgccgtacatcagccacacgatgcgtggcggcgctcgcatgggcaacgtggagttc
aaggacgcgatgatccacgacggcctctgggacgtgtacggcaacgtccacatgggcaac
tgcgcggaggagtgcgccacgtcgcagaacatcagccgcgcgcagcaggacgagttcgcg
ctggagtccacccgccgcgccatccagtcccagaaggaggggctgttcgccgcggagatc
gtccccgtggtgattcctggcaagaagccgggtgaggagacgacggtgtccgaggacgag
ggtcctcgcaacgccaagccggacaagattccgggcctgaagcccgtgttcaagaaggac
ggcacggtgacggccgccaacgcgtcctccatcaacgacggcgccgcggcgctggtgctg
atgagcgaggagcgggcgaaggcggaggggaagaccatcctcggccgcatcaccggctac
gcgcaggccgctcgcaagccggtggagttcaccatcgcgccggcggacgccatcaacacg
ctcctgacgaagaagggcgtgaaggcggcggacgtggacctgtgggagatcaacgaggcg
ttcgcggtggtggccatcgccaacaaccgcctcctcgggctggaccccgcgaaggtgaac
gtgcgcggcggcggcgtggtgctgggtcaccccatcggcgcgtcgggtgcgcgcgtgctg
gtgacgctgcttcagacgatgaaggaccagggcaagaagcggggcgtcgcgtcgctgtgc
atcggcggcggcgagggcatcgcgctgatggtggagcggtag

DBGET integrated database retrieval system