KEGG   Myxococcus stipitatus: MYSTI_04257Help
Entry
MYSTI_04257       CDS       T02436                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
msd  Myxococcus stipitatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:msd00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5440534..5442738
Genome map
AA seq 734 aa AA seqDB search
MRKPADKAHVDTEVRRVVELRHPEPHSVLGIHPDGDGVVVRAYRPDAVSIHVLRDGGDRI
PMQHRDDGVFEARVNNCKSTFSYLLEVEYPGKRVFKLRDPYSFLPTLGEMDLYYAGEGRH
ERLWERMGAHLIHHNGTKGVSFAVWAPTAAGVSVVGDFNSWDGRLHAMRRMGASGIWELF
IPEVGEGTRYKFEIRPGQGGPRLLKADPFAFRTEVPPSTASVVHDLGHHRWEDAAWLEAR
SQRGDVARHPWSVYEVHLGSWRHVVEDGDRPMTYRELAPALAEYVKHMGFTHVELLPVAE
YPYGGSWGYQVSGYYAPTARYGHPDDFRFLVDHLHKEGIGVIIDWVPGHFPRDSHALGEF
DGTSLYEHSDPRKGAQPDWGTLVFNFGRNEVRNFLIANALFWIEEYHVDGLRVDAVASML
YLDYSRKQGEWIPNRWGGRENEEAIQFLRELNDTVRRKHPGVVVIAEESTAWPKVSSPTS
EGGLGFHFKWNMGWMHDTLSYFSKDPIYRQYHHNQLTFGLLYAFSEHFMLPLSHDEVVHG
KGSLYGRMPGDPWQKRANLRALFAWMWAHPGKKLLFMGGEFGQPAEWNHDKSLDWHLTKD
PGHQGIQRLVATLNRIYKELPALHDADNEPVGFQWLQPDAASDNVLAFVRRSRQPGRHVV
CVANLSPAVRENFRVGFPLHGSYVEVLNTDASEYGGSNVGNLGQLRTEATGWDGQPASAL
LTLPPLSVMWFTPG
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaagcccgcggacaaggcgcacgtcgacacggaagtccgacgcgtggtggagctg
cggcacccggagcctcactcggtgctcggcatccacccggacggcgacggcgtggtggtg
cgcgcctatcgcccggacgcggtgagcatccacgtcctgcgcgacggcggagaccgaatc
cccatgcagcaccgcgacgacggtgtcttcgaggcccgcgtcaacaactgcaagtcgacc
ttcagctacctgctggaggtggagtaccccggcaagcgcgtcttcaagctgagagacccg
tacagcttcctacccaccctgggggagatggacctgtactacgcgggggaaggccgccat
gagcggctctgggagcggatgggcgcgcacctcatccaccacaacggcaccaagggggtg
tcgttcgccgtctgggcccccaccgccgcgggcgtctccgtggtgggcgacttcaacagc
tgggacgggcgactgcatgcgatgcgccgcatgggcgcctccggcatctgggagctgttc
atccccgaggtgggcgaaggcacccgctacaagttcgagatccgccccggccaaggcggc
ccgcgcctgctgaaggcggacccgttcgcgttccgcacggaggtgccgccctccaccgcg
tccgtggtgcatgacctgggacaccaccgctgggaggacgccgcgtggctggaggcgcgg
agccagcgaggcgacgtcgcgcgccatccgtggagcgtgtacgaggtgcacctggggagc
tggcgccacgtggtggaggatggcgaccggcccatgacgtaccgcgagctggcgcccgcg
ctggccgagtacgtcaagcacatgggcttcacccacgtggaattgctccccgtcgcggag
tacccctacggcggctcctggggctatcaggtcagcggctactacgcgcccacggcccgc
tacggccatccggatgacttccggttcctggtggaccacctgcacaaggaaggcatcggc
gtcatcatcgactgggtgcccggccacttcccccgggactcccacgcgctgggcgagttc
gatggcacgtcgctgtacgagcactcggacccgcgcaagggcgcgcagccggactggggc
acgctggtcttcaacttcggccgcaacgaggtgcgcaacttcctcatcgccaacgcgctg
ttctggatcgaggagtaccacgtcgatgggctgcgcgtggacgcggtcgcgtcgatgctc
tacctcgactacagccgcaagcagggcgagtggattcccaaccgctggggcggccgggag
aacgaagaggccatccagttcctgcgcgagctcaacgacaccgtgcgccgcaagcacccg
ggcgtcgtcgtcatcgccgaggagtccaccgcgtggcccaaggtctcctcccccacgagc
gagggcggcctgggcttccacttcaagtggaacatgggatggatgcacgacacgctgtcg
tacttctccaaggaccccatctaccggcagtaccaccacaaccagctcaccttcgggctg
ctgtatgcgttcagcgagcacttcatgttgccgctgagccatgacgaggtggtgcacggc
aagggcagcctctacggccgcatgccgggggacccgtggcagaagcgggccaacctgcgc
gcgctgttcgcgtggatgtgggcccacccgggcaagaagctgctcttcatgggcggcgag
ttcggccagcccgcggagtggaaccacgacaagagcctggactggcacctgacgaaggac
ccgggacaccagggcatccagcgcctcgtcgcgacgctgaaccgcatctacaaggagctg
ccggcgctccacgacgcggacaacgagcccgtgggcttccagtggctccagcccgacgcc
gcgtcggacaacgtgctcgcgttcgtccgccgctcgcgccagcccgggcgccatgtcgtg
tgcgtggccaacctctcccccgccgtgcgcgagaacttccgcgtgggcttcccgctgcac
ggcagctacgtggaggtgctcaacaccgacgcgagcgagtacggcggctccaacgtgggc
aacctcggccagctccgcacggaagccacgggctgggatgggcaacccgcgtcggcgctg
ctcaccctgcccccgctgtccgtgatgtggttcacgccgggctga

DBGET integrated database retrieval system