KEGG   Myxococcus stipitatus: MYSTI_04917Help
Entry
MYSTI_04917       CDS       T02436                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
msd  Myxococcus stipitatus
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MYSTI_04917
Enzymes [BR:msd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     MYSTI_04917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6296217..6297254
Genome map
AA seq 345 aa AA seqDB search
MATHFDPSAAAQPGSGVFGLPHSPDEAHVVLIPVPFEATTSYGGGTSDGPAAVLDASRQV
DLFDVETGRPYERGIAMLPESQELRDWNTRAKERAQVVIDAGGIHSGEAELLAAAKDVNV
LCDQMNDYVYRTAKHWLEQGKRVAAVGGDHSISFGIIRAHAEKYPGLGVLHLDAHADLRV
AYEGFTWSHASIMYNVAERIPGVKTLVQVGLRDMSQEEHRYIEDSKGRVHGFFDATLQNN
RFDGIPWNRQVDEIVALLPQHVYLSFDIDGLDPVLCPHTGTPVPGGLSFPEAIALLSGVA
RSGRTIVGFDLTEVAPDPEGGEWDGNVGARLLYKMIGWMLKSQKA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggccacccacttcgaccccagcgccgccgcacagccgggttccggcgtcttcggactc
ccccactctcccgacgaggcgcacgtcgtcctcatccccgtccccttcgaggccaccacc
agctacggcggcggcacgtccgacggccccgccgcggtcctcgacgccagccgccaggtg
gacctcttcgacgtcgagaccggccgcccctacgagcgcggcatcgccatgctccccgag
tcccaggagcttcgcgactggaacacccgcgccaaggagcgcgcccaggtcgtcatcgac
gcgggcggcatccactccggcgaggcggagctcctcgcggccgccaaggacgtcaacgtc
ctctgcgaccagatgaacgactacgtctaccgcaccgccaagcactggctggagcagggc
aagcgcgtggccgccgtcggaggagaccactccatctccttcggcatcatccgcgcccac
gccgagaagtaccccggcctcggcgtgctgcacctggatgcccacgccgacctgcgcgtc
gcctacgagggcttcacctggtcccacgcctccatcatgtacaacgtcgccgagcgcatc
cccggcgtgaagacgctggtccaggtcggcctgcgcgacatgagccaggaagagcaccgc
tacatcgaggactcgaagggccgcgttcacggcttcttcgacgccaccctccagaacaac
cgcttcgacggcatcccctggaaccgccaggtcgatgaaatcgtcgccctgctgccccag
cacgtctacctgtcgttcgacatcgacggcctggaccccgtcctctgcccccacaccggc
acgcccgtccccggcggcctgtccttccccgaggccatcgccctgctgtccggcgtggcc
cgctccggccgcaccatcgtcggcttcgacctgacggaagtcgccccggaccccgagggt
ggggagtgggacggcaacgtgggtgcccgcctgctctacaagatgattggctggatgctg
aagtcccagaaggcctga

DBGET integrated database retrieval system