KEGG   Myxococcus stipitatus: MYSTI_04978Help
Entry
MYSTI_04978       CDS       T02436                                 

Definition
(GenBank) fatty oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
msd  Myxococcus stipitatus
Pathway
msd00071  Fatty acid degradation
msd00280  Valine, leucine and isoleucine degradation
msd00281  Geraniol degradation
msd00310  Lysine degradation
msd00362  Benzoate degradation
msd00380  Tryptophan metabolism
msd00410  beta-Alanine metabolism
msd00640  Propanoate metabolism
msd00650  Butanoate metabolism
msd00903  Limonene and pinene degradation
msd00930  Caprolactam degradation
msd01040  Biosynthesis of unsaturated fatty acids
msd01100  Metabolic pathways
msd01110  Biosynthesis of secondary metabolites
msd01120  Microbial metabolism in diverse environments
msd01130  Biosynthesis of antibiotics
msd01200  Carbon metabolism
msd01212  Fatty acid metabolism
Module
msd_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MYSTI_04978
   00650 Butanoate metabolism
    MYSTI_04978
  Lipid metabolism
   00071 Fatty acid degradation
    MYSTI_04978
   01040 Biosynthesis of unsaturated fatty acids
    MYSTI_04978
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MYSTI_04978
   00310 Lysine degradation
    MYSTI_04978
   00380 Tryptophan metabolism
    MYSTI_04978
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MYSTI_04978
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MYSTI_04978
   00281 Geraniol degradation
    MYSTI_04978
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MYSTI_04978
   00930 Caprolactam degradation
    MYSTI_04978
Enzymes [BR:msd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MYSTI_04978
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MYSTI_04978
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MYSTI_04978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 UDPG_MGDP_dh_N NAD_binding_2 F420_oxidored NAD_Gly3P_dh_N 2-Hacid_dh_C DAO NAD_binding_8 ApbA
Motif
Other DBs
NCBI-ProteinID: AGC46266
UniProt: L7UBI7
Position
6403250..6405427
Genome map
AA seq 725 aa AA seqDB search
MSEQNTIRWEQDADGIVLLTMDDPNQSANTMNAAYIASMRATVNRLAQEKATITGVILTS
AKKTFFAGGDLKDLLRIRKEDAKQAFEFGQEIKAQLRVLETLGKPVVAAINGAALGGGLE
IALACHRRIVADVKGAQIGLPEVTLGLLPGGGGVVRTVRMLGIVDAMMKVLLQGQRYRPK
EAQEVGLVHEVVDSVEALLPAAKAWVKANPSAQQPWDAKGYKIPGGTPSSPGLATNLPAF
PANLRKQIKGTNLPAPRAIMAVAVESTQVDVDTAFTIESRYFTELVTGQVAKNMIQAFFF
DMQHINSGGGRPKGHPQHTAKKVGVLGAGMMGAGIAYVCAKAGIDVVLKDVSQAAADKGK
QYSVKLVEKGVQKGKTTKEKGDALLARITPTSDPAALQGCDLVIEAVFESVELKHKVFQE
VQGVVAPDAVLASNTSTLPITQLAEGVKRSEDFVGMHFFSPVDKMPLLELIAGKKTSDAT
LAKAIDIAVQIGKTPIVVNDSRGFFTSRVIGTFLNEAIAMVGEGLAPASIEQAGLQAGYP
AAPLSLMDELTLTLPRKIRQETKAAVEASGQTWVEHGSATVIDALIDQHGRKGRSTGGGF
YDYADDKRTGLWPGLAQHFTRAGHTIPFEDMKDRMLFAEAIDTVRCFDEGVLRSAADANI
GSILGIGFPPWTGGVVQFINGYEGPTGTSLKGFILRARELAERYGKHFLPPASLVEKAER
GELLK
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcagaacaccatccgctgggaacaggatgccgacggcatcgtcctcttgacg
atggacgacccgaaccagtccgccaacacgatgaacgccgcgtacatcgcgtccatgcgt
gcgaccgtgaaccggctggcccaggagaaggccaccatcaccggcgtcatcctcacgtcc
gccaagaagaccttcttcgccggcggagacctcaaggacctgttgcgcatccgcaaggag
gacgcgaagcaggccttcgagttcgggcaggagatcaaggcgcagctgcgcgtgctggag
acgctgggcaagcccgtcgtcgccgccatcaacggcgcggcgctgggcggcgggctggag
attgccctcgcgtgtcaccgccgcatcgtcgccgacgtgaagggcgcgcagattggcctg
ccggaagtgacgctgggcctgttgcccggtggcggcggcgtggtgcgcaccgtgcgcatg
ctgggcatcgtggacgcgatgatgaaggtgctgctccagggccagcgctaccgtcccaag
gaggcccaggaggtgggcctggtgcatgaggtggtggactccgtggaggcgctcctgccc
gcggccaaggcgtgggtgaaggcgaacccgagcgcgcagcagccgtgggacgccaagggc
tacaagattccgggcggcacgccgtcctcgcccggcctggcgaccaacctgcccgccttc
cccgccaacctgcgcaagcagatcaagggcacgaacctgcccgccccgcgcgccatcatg
gccgtggcggtggagagcacgcaggtggacgtggacaccgcgttcaccatcgagtcgcgc
tacttcaccgagctcgtcacgggccaggtcgcgaagaacatgattcaggcgttcttcttc
gacatgcagcacatcaactccggcggcggccgccccaagggccatccgcagcacaccgcg
aagaaggtgggcgtgctgggcgcggggatgatgggcgcgggcatcgcctacgtgtgcgcc
aaagcgggcatcgacgtggtgctcaaggacgtgagccaggccgccgcggacaagggcaag
cagtactccgtcaagctcgtggagaagggcgtccagaagggcaagacgacgaaggagaag
ggcgacgcgctgctggcgcgaatcacccccacctcggacccggcggcgctccagggctgc
gacctggtcatcgaggccgtcttcgagagcgtggagctcaagcacaaggtcttccaggag
gtccagggcgtcgtggccccggacgcggtgctggcgtccaacacctccacgctgcccatc
acccagctggcggaaggggtgaagcgctcggaggacttcgtgggcatgcacttcttctcc
cccgtggacaagatgccgctgctggagctcatcgcgggcaagaagacgagcgacgccacg
ctggcgaaggccatcgacatcgcggtgcagatcggcaagacgcccatcgtcgtcaatgac
agccggggcttcttcaccagccgcgtcatcggcacgttcctcaacgaggccatcgccatg
gtgggcgagggcctggcccccgcgtccatcgagcaggcgggactccaggcgggctacccc
gccgcgccgctgtccctcatggacgagctcacgctgacgctgccgcgcaagatccgccag
gagacgaaggcggccgtggaggcctccggccagacgtgggtggagcacggcagcgccacg
gtcatcgacgcgctgattgaccaacatgggcgcaagggccgctccaccggtggtggcttc
tacgactacgcggacgacaagcgcacgggcttgtggccgggcctcgcccagcacttcacc
cgcgcgggccacaccatccccttcgaggacatgaaggaccggatgctattcgccgaggcc
atcgacacggtgcgctgcttcgacgagggcgtgctgcgctcggcggcggacgccaacatc
ggctccatcctgggcatcggcttcccaccctggacgggcggcgtggtccagttcatcaac
ggctatgagggccccaccggcaccagcctgaagggcttcatcctccgggcgcgagagctg
gcggagcgctatggcaagcacttcctgccccccgcgtcgctcgtcgagaaggccgagcga
ggcgagctgctgaagtag

DBGET integrated database retrieval system