KEGG   Myxococcus stipitatus: MYSTI_05211Help
Entry
MYSTI_05211       CDS       T02436                                 

Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
msd  Myxococcus stipitatus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:msd00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MYSTI_05211
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    MYSTI_05211
Enzymes [BR:msd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     MYSTI_05211
Two-component system [BR:msd02022]
 CheA family
  CheA-CheYBV
   MYSTI_05211
Bacterial motility proteins [BR:msd02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    MYSTI_05211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6693877..6694914)
Genome map
AA seq 345 aa AA seqDB search
MSERTPVSVLVVDDSAQNRYTLTRLLESTPDVRVLDRAADGEEGLKKVLELKPDVVTLDL
EMPKLGGFTFLRLLMRTSPTPVIVISSYAHRSDVFKALELGAFDFIAKPARGTQEELEKM
RVELLEKVHAALHVRPGQRHASPGARALAVAGELPLVVAVGASTGGPPAVQRVLEGLASE
PTPCVLVSQHMPAQFTRAFAERLDRIGPFTVTEASEGDVVQPGHVYIAPGGRHLVVVERG
TRLELHTPPPTPLDKYAPSVDRLFTSVAQVLGNRALAVVLTGMGADGAQGAREIQRAGGE
VWAESEETAVVFGMPGEAVAAGAVKRVLRLGEIGPALAAWARKRR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcggactcctgtctcggtgctggtcgtcgacgactcggcgcagaaccgctac
acgctgacccggttgctggagtccacgcccgacgtgcgcgtcctcgatcgggcggcggat
ggtgaggaggggctgaagaaggtcctggagctgaagccggacgtggtgacgctggacctg
gagatgcccaagctggggggcttcacgttcctccggctcctgatgcgcacgtcgcccacg
ccggtcatcgtcatctccagctacgcgcaccgctcggatgtcttcaaggcgctggagctg
ggggccttcgacttcatcgccaagcccgcgcgaggcacgcaggaagagctcgagaagatg
cgcgtggagctgctcgagaaggtgcacgcggcgctgcacgtgcggcccggacagcgtcac
gcgtcgccgggggcacgtgcgctcgcggtggcgggggagcttccgctggtggtggcggtg
ggcgcgtcgacgggaggtccgcccgcggtgcagcgcgtcctggaggggctcgcctcggag
ccgacaccttgtgtgctggtgagtcagcacatgcccgcgcagttcacccgggccttcgcg
gagcggctggaccgcatcggcccgttcacggtgacggaggcgagcgagggggatgtggtg
cagccgggccacgtctacatcgccccgggaggccgacacctcgtggtggtggagcgaggc
actcgcctggagctgcacaccccgccccccacgcccttggacaagtacgcgccgagcgtc
gaccggctcttcaccagcgtggctcaggtgctgggcaatcgagcgctggcggtggtgctg
acggggatgggcgcggatggagcccagggggcgcgggagattcagcgcgcgggcggcgag
gtctgggccgagtccgaggagacggcggtggtcttcggcatgccgggggaggccgtcgcg
gcgggggcggtgaagcgggtgctccggctgggagagattggacccgccctggcggcatgg
gcccggaagcggcggtga

DBGET integrated database retrieval system