KEGG   Myxococcus stipitatus: MYSTI_05397Help
Entry
MYSTI_05397       CDS       T02436                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
msd  Myxococcus stipitatus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MYSTI_05397
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MYSTI_05397
Enzymes [BR:msd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     MYSTI_05397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6987538..6988809
Genome map
AA seq 423 aa AA seqDB search
MDKIVMKGGAELHGEVPVSGAKNAALPILASALLADGTSTFRNVPDLADVATMLKVLRTM
GCGAERLEGRKKDVCEVGVNGHITPEAPYDLVKTMRASVLVLGPLVARFGRARVSMPGGC
AIGARPIDQHLKGLKALGAEIHLTEGYVEARAKQLKGGTVNFDVITVTGTENVLMAAVLA
KGRTVMENCAREPEIEELAKVLNKMGARIEGAGTSIITIEGVEGLTPVEHAILPDRIEAG
TLLVAAAISGGNVLVKHAVPEHLDAVMDKLREAGCTLTAEAGGIRCKAPKTLTSVNITTT
EHPGFPTDMQAQLMALMCVSQGTSVISENIFENRFMHVPELHRLGADITIQGHTAVVKGV
KTLSGAPVMATDLRASASLILAGLRAEGRTDVSRVYHLDRGYERLERKLRALGADIRRVK
AKA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggacaagatcgtgatgaagggcggcgccgagctgcacggcgaggttcccgtgtcgggc
gcgaagaacgcggcgctgcccatcctggcctccgcgctgctggcggatggcacgtccacg
ttccgcaatgtgccggacctggccgacgtcgccaccatgctcaaggtgctgcgcaccatg
ggctgtggcgcggagcggctggagggccgcaagaaggacgtctgcgaggtgggcgtcaac
ggccacatcaccccggaggcgccgtacgacctggtcaagacgatgcgcgccagcgtgctc
gtgctggggccgctcgtcgcgcgcttcgggcgggcccgggtgtccatgccgggcgggtgc
gccatcggcgcgcggcccatcgaccagcacctcaagggcctcaaggcgctgggcgcggaa
atccacctgacggagggctacgtggaggcccgcgccaagcagctcaagggcggcaccgtc
aacttcgacgtcatcaccgtcacgggcacggagaacgtgctgatggcggccgtgctggcc
aagggccgcaccgtgatggagaactgcgcccgcgagcctgaaatcgaggagctggccaag
gtcctcaacaagatgggcgcgcgcatcgaaggcgccggcacgtccatcatcaccatcgag
ggcgtggagggcctcacccccgtggagcacgccatcctcccggaccgcatcgaggcgggc
acgctgctcgtggcggcggccatctccggcggcaacgtgctggtgaagcacgcggtgccc
gagcacctggacgccgtcatggacaagctgcgcgaggcggggtgcacgctgaccgcggag
gccgggggcatccggtgcaaggcgcccaagacgctcacctcggtgaacatcaccaccacc
gagcacccgggcttccccaccgacatgcaggcgcagctcatggccctcatgtgtgtgagc
cagggaacatctgtcatcagcgagaacatcttcgagaaccgcttcatgcacgtgccggag
ctgcaccgtctgggcgcggacatcaccatccagggacacaccgcggtggtgaagggcgtg
aagacgctgagcggcgcgcccgtcatggccacggacctgcgggcaagcgcttcgctcatc
ctggcgggcctgcgcgccgaggggcgcacggacgtcagccgcgtctaccacctggaccgg
ggctatgagcgactggagcgcaagctgcgtgccctgggtgcggacatccggcgcgtcaag
gcgaaggcctga

DBGET integrated database retrieval system