KEGG   Myxococcus stipitatus: MYSTI_05465Help
Entry
MYSTI_05465       CDS       T02436                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
msd  Myxococcus stipitatus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:msd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MYSTI_05465
Enzymes [BR:msd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MYSTI_05465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7067486..7068094)
Genome map
AA seq 202 aa AA seqDB search
MIARLRGVVLEKDAEGAVIDVQGVGYQVNFSSLSLGKLPPEGQPVDVRVRTVVREDAFDL
FGFLSKAEEDVFLLLNGVSRVGPRMALGVLSGMEVPELVAALSRGEVARLAKIHGVGKKT
AERLVLELKDKMKTVHLEAVSRGTAPAPEGGTHSDLVSALLNLGYKPPQAEKAAELATSR
LGADASFQALFREALKSLRAGG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgattgctcggctgcgtggcgtggttctggagaaggatgccgaaggcgctgtcattgac
gtgcagggtgtgggctaccaggtgaacttctcgtcgctgtcgctcggcaagctgcccccg
gaagggcagcccgtcgacgtgcgcgtgcgcaccgtcgttcgcgaggacgccttcgacctc
ttcggcttcctgtccaaggcggaggaggacgtctttctcctgctcaacggtgtctcgcgc
gtggggccccgcatggcgctgggcgtgctgtccggcatggaggtgccggagctggtggcg
gcgctgtctcgtggagaggtggcgcggctggccaagatccacggcgtcggaaagaagacc
gccgagcggctggtgctggagctcaaggacaagatgaagaccgtccacctggaggcggtg
tcccgaggtaccgcgccagcacccgagggggggacacactccgacctcgtctccgctttg
ctcaacctgggctacaagcccccccaagcggagaaggccgcggagctcgccaccagccgg
ctgggcgccgacgcctccttccaggccctcttccgcgaggccctcaagtccttgagggcc
ggcggctga

DBGET integrated database retrieval system