KEGG   Myxococcus stipitatus: MYSTI_05670Help
Entry
MYSTI_05670       CDS       T02436                                 

Definition
GMC oxidoreductase family protein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
msd  Myxococcus stipitatus
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    MYSTI_05670
Enzymes [BR:msd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     MYSTI_05670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7310118..7311746)
Genome map
AA seq 542 aa AA seqDB search
MDCDWLIIGSGFGGSASALRLTEKGYRVVMLEKGRRLGPADFPKTNWNLRRWLWMPRLGW
RGLFKMTFFRHVTVLSGVGVGGGSLVYANTLPVPKDDFFDAPSWGHLAPWKQELPEHYLT
ARRMLGATVNPLVTESDRVLEQVGQDLGRTDFQPTTVAVYFGEPGVTVKDPYFGGEGPDR
TGCIACGGCMLGCRHGAKNTLDRNYLYLAEKRGLSLHADTEATWVRPLPGGGYEVEARQG
SGWLPRRKRRFLARNVIFAGGVLGTLDLLLRLKEHPDGLPRLSERLGDGVRTNSEALIGI
VSGRKELDLSKGIAIGSILHTDERSHLEPVRYPEGSGFFRLLMAPQVRGARMLSRLARLV
GLLARHPLRFLKAWFVPNFARRTVILLYMRTLEGHLRMQRRRGLTTGLRKGLVTGLQEGP
APTTNMPEAFDLAQRVSEKLDGYPMTMVSETVLGIPTTAHILGGCCMGDSAETGVIDHRH
RVFGYQGLYVVDGSAISANPGVNPSLTITALAERAMTFIPHAREVDEQAPSGEMAPLKHA
NR
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggattgcgactggctcatcatcggctcgggctttggcgggagcgccagtgcgctgcgg
ttgaccgagaagggctaccgcgtggtgatgctggagaagggccggcggctgggccccgct
gactttccgaagacgaactggaacctgcggcgctggctgtggatgccccggctcggctgg
cgcgggctcttcaagatgacgttcttccggcacgtcaccgtgttgtccggcgtgggcgtg
ggcggaggctcgctcgtctacgcgaacaccctgccggttccgaaggacgacttcttcgat
gcaccgtcctggggccacctcgccccctggaagcaggaactgcccgagcactacctcacc
gcgcggcgcatgctcggcgccaccgtcaatccgctcgtcaccgagtcggaccgcgtcctc
gagcaggtaggccaggacctgggccggacggacttccagcccacgacggtggccgtgtac
ttcggcgagccgggtgtcaccgtgaaggacccctacttcggtggagaggggccggaccgc
accggctgcatcgcctgtggcggttgcatgttgggctgcaggcacggcgcgaagaacacg
ctggaccgcaactacctctacctcgcggagaagcggggcctgtcgctgcacgccgacacc
gaggcgacgtgggtgcgtccgctgcccggaggcggctacgaggtggaggcgcgccagggc
tcgggctggctgcctcgaaggaagcggcgcttcctcgcgcgcaacgtcatcttcgcgggt
ggcgtgctgggaaccctggacctgctgcttcgactcaaggagcacccggacggactcccc
cggctgtccgagcgcctgggggacggcgtgcgcaccaactccgaggcgctcatcggcatc
gtcagcgggcggaaggaactggacctctcgaagggcatcgccatcggctccatcctgcac
accgacgagcgctcgcacctggagccggtgcgctacccggagggctcggggttcttccgg
ctgctgatggcgccccaggtgcgcggcgcgaggatgctctcgcggctggcccgactcgtg
gggctgctcgcgcggcacccgctgcgcttcctcaaggcctggttcgtcccgaacttcgcg
cggcggaccgtgatcctcctctacatgcgcacgttggaagggcacctgcgcatgcagcgc
cggcgcgggctgaccacggggctgcgcaagggactcgtcaccgggttgcaagaaggcccc
gcgcccaccaccaacatgccggaggcgttcgacctggcccagcgtgtctcggagaagctg
gacggctacccgatgacgatggtgagcgagacggtgctgggcatccccacgacggcgcac
atcctcggagggtgttgcatgggggactcggcggagacgggcgtcatcgaccaccgccac
cgcgtcttcggctaccagggcctgtacgtggtggacggctcggccatctccgcgaacccc
ggcgtcaatccctcgctcaccatcaccgcgctcgcggagcgcgccatgacgttcatccct
cacgcgcgggaggtggacgagcaggcgccatccggtgagatggcgccgttgaagcacgcg
aaccgctga

DBGET integrated database retrieval system