KEGG   Myxococcus stipitatus: MYSTI_05923Help
Entry
MYSTI_05923       CDS       T02436                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
msd  Myxococcus stipitatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYSTI_05923
Enzymes [BR:msd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MYSTI_05923
Exosome [BR:msd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MYSTI_05923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7635171..7637069)
Genome map
AA seq 632 aa AA seqDB search
MRRNMWSALLLAGVLGCAESALENPLGTKGEETGQVVQRLSSSNRPGMGAVVYGGGTTFR
VWAPLASQVFVAGDFSSWGWVELGNEFNGNFSGDVAGAVKGQKYKFVTRNQWGSDSWRAD
PRSAWQENSTGASIIYDHGEYWWNAQQFSTPAFHEMVIYELHVGTFNDSPGWGPGNWNSA
IAKLDYLRDLGVNMVKVMPAYEFAGDFSWGYNVAFPFAPESAYGHPNDMKRFVDEAHYRG
IGVIVDVVHNHWGPSDLPMWCFSGNCLGNGGEYFFTDNRKSTPWGDTRPDYGRPEVRAYI
RDSMMNLLDNFRADGLRWDATKYMRTIDGAGDIAPAWQVFRSINREINANKGWKISIAED
FGGGDSITNDATSDFAGGAGFDAQWSAEFVHPIRTAVIEQNDANRNMFAVRDAITQRFSG
RAHARVIYSESHDEVANGKQRLPEEIWPGQAGSWAAKKRSTLAAGVTLTSPGIPMLFQGQ
EILEDGFFADGDPVDWGKLSTYGGIHDLYRDLIRLRRNWSNNTRGLRGGNVNVHHVNNTG
KVLAYHRWDSGGPGDDVLIVANFSGTYFPTYNIGFPRTGTWYLRFNSDWNGYSSDFGNTA
SANTVAYGGAKDGMANNASFAIGPYSLLIFSQ
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgcaacatgtggagtgcgctgctgctggccggagtgttgggctgcgcagagagc
gcgctcgagaatccactgggcacgaagggcgaggagacaggacaggtcgtccagcgcctc
agctcctcgaatcggccgggcatgggggcggtggtctacggcggcggcacgacgttccgc
gtgtgggcgccactggcctcccaggtgttcgtcgcgggtgacttcagcagttgggggtgg
gtggagctgggcaacgagttcaacggcaacttctccggcgacgtggcgggcgcggtgaag
gggcagaagtacaagttcgtcacgcgcaaccagtgggggagcgattcctggcgcgcggac
ccgcgctcggcgtggcaggagaactccacgggcgccagcatcatctacgaccacggcgag
tactggtggaacgcgcagcagttcagcacgccggccttccacgagatggtcatctacgag
ctgcacgtgggcacgttcaacgactcgccggggtgggggccgggcaactggaacagcgcc
atcgcgaagctcgactacctgcgggacctgggcgtcaacatggtgaaggtgatgccggca
tacgagttcgctggcgacttctcctggggctacaacgtcgccttcccgttcgcgccggag
agcgcctacggccaccccaacgacatgaagcgcttcgtggacgaggcgcactaccggggc
atcggtgtcatcgtcgacgtggtgcacaaccactgggggcccagcgacctgcccatgtgg
tgcttcagcggcaactgcctgggcaacggtggggagtacttcttcaccgacaaccgcaag
tcgacgccgtggggggacacgcgtccggactacggccgccccgaggtgcgtgcgtacatc
cgcgactcgatgatgaacctgctcgacaacttccgggcagatggcctgcgctgggatgcc
acgaagtacatgcgcaccatcgacggcgcgggcgacatcgcgccggcgtggcaggtgttc
cgctccatcaaccgcgaaatcaacgcgaacaagggctggaagatctccatcgccgaggac
ttcggcggcggcgactccatcaccaacgacgccacgtccgacttcgcgggcggcgcgggc
ttcgacgcgcagtggtcggcggagttcgtgcatcccatccgcacggcggtcatcgagcag
aacgacgcgaaccggaacatgttcgcggtgcgcgacgcgattacccagcgcttcagcggg
cgggcgcacgcgcgcgtcatctactcggagagccacgacgaggtggccaacggcaagcag
cggttgccggaggagatctggccgggacaggcggggagctgggcggcgaagaagcgctcc
acgctggccgcgggtgtcactctcacgtctccgggcatccccatgctgttccagggacag
gagattctggaggacgggttcttcgcggacggagacccggtggactggggcaagctcagc
acctacggcggcatccacgacctctaccgggacctcatccgcctgcgccgcaactggagc
aacaacacgcgcggcctgcggggaggcaacgtcaacgtccaccacgtcaacaacacgggc
aaggtgcttgcctatcaccgctgggacagtggtgggcctggggacgacgtcctgattgtc
gccaacttcagcggcacctacttccccacctacaacatcggcttcccgcgcacgggcacg
tggtacctgcgcttcaacagcgactggaacgggtactcgtccgacttcggcaacaccgcg
tcggccaacacggtggcgtatggcggcgccaaggatggcatggcgaacaacgcgtccttc
gccatcggcccctactcgctgctcatcttctcgcagtaa

DBGET integrated database retrieval system