KEGG   Myxococcus stipitatus: MYSTI_06146Help
Entry
MYSTI_06146       CDS       T02436                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
msd  Myxococcus stipitatus
Pathway
msd00330  Arginine and proline metabolism
msd01100  Metabolic pathways
Module
msd_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MYSTI_06146
Enzymes [BR:msd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     MYSTI_06146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AGC47419
UniProt: L7ULT0
Position
7956180..7957067
Genome map
AA seq 295 aa AA seqDB search
MSSRMRHASCPEESQARAVLFGANTQGAGFSESARGKSDAPRKLFTADVVRDADNESPSL
TELLEDGASLFDAGNLPVEGLAANEQLAVVHARFVELFRAGQRAIGVGGDHFIKYAALSA
VSEVFEDCAVLYVDAHPDCAQNEALGFDSILHHAWKLPHIRPERTCIFGVRQVNARERDG
LRAWRPGVVAATELVERGLPAVLEMMAAQLGDVRRVFVSVDLDGLAPHEVPAVEAPYPGG
PTFRELLVLLRGLARRYELVGMDVSEFIPELDTARLTALVTARLVKEFAALPAPR
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccggatgcgccatgcctcgtgtcccgaggagtcccaggcccgtgccgtgctg
ttcggcgccaacacccagggggccggcttctccgagagcgcgcgggggaagtcggatgcg
ccccggaagctgttcaccgccgatgtggtgcgagacgcggacaacgaatcgccgtcgctc
acggagctgctggaggacggggcctcgctgttcgatgcggggaacctgccggtggagggg
ctcgcggcgaacgagcagctcgcggtcgtgcatgcccgcttcgtggagctcttccgagcg
gggcagcgcgccatcggcgtgggcggggaccacttcatcaagtacgcggccctgtcggcc
gtgagcgaggtgttcgaggactgtgccgtcctctacgtggatgcgcacccggactgcgca
cagaacgaggcgctcggcttcgactccatcctccaccacgcgtggaagttgccccacatc
cggccggagcggacgtgcatcttcggcgtccggcaggtgaatgctcgggagcgggatgga
ctgcgcgcgtggaggccgggcgtcgtcgccgcgacggagctggtcgagcgaggactgccc
gcggtgctcgagatgatggccgcgcagctcggcgacgtgcggcgggtgttcgtgtcggtg
gacctggatgggctcgcgccgcacgaggtccccgccgtcgaggcgccctaccctggtggc
cccaccttccgggagctgctcgtgctcctgcgggggctggctcggcgctacgagctggtc
ggcatggacgtgagtgagttcatcccggagctggatacggctcggctcaccgcgctcgtc
accgcgcggctggtgaaggagttcgcggcgctgcccgcgccgaggtga

DBGET integrated database retrieval system