KEGG   Myxococcus stipitatus: MYSTI_06663Help
Entry
MYSTI_06663       CDS       T02436                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
msd  Myxococcus stipitatus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYSTI_06663
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MYSTI_06663
  Amino acid metabolism
   00310 Lysine degradation
    MYSTI_06663
Enzymes [BR:msd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MYSTI_06663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8583958..8585172
Genome map
AA seq 404 aa AA seqDB search
MAVELKVPPLGESITEAVVGKWNKKAGDAVTADEPLVVLETDKVTIDVPAPAAGSLASVA
FKEGDKVRVGDVLGLIEAGAGAPAAKPAAAAPAAPAPAPVAAAAEASGGSDARITPTARK
MAEENKLDVSQLKGSGTAGRITKEDVLGQLNRPTAPSQPAAPATPAGPRPNAAREERVRM
TPLRKRVAERLVQAQSTAALLTTFNEVDMGEVMALRKKYNDKFLAKHGVKLGFMSFFVRA
SIEALKAFPQVNGEIDGEDVIFKHYYDIGVAVSGSRGLVVPVLRNADKLSLAELEKGVAD
LGTRARNDKLGLADLQGGTFTITNGGIFGSMLSTPIINPPQTGILGMHNIVERPVVRDGQ
IVIRPIMYVALTYDHRLIDGREAVQFLVRVKECIEDPERLLLDV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggccgttgaactgaaagtgccccccctgggtgagtccatcaccgaggccgtcgtcggc
aagtggaacaagaaggccggtgacgcggtgacggcggacgagccgctcgtcgtccttgag
accgacaaggtcaccatcgacgtgcccgctcccgcggccggctccctggccagcgtcgcc
ttcaaggagggcgacaaggtgcgcgtgggtgacgtgctcggcctcatcgaggccggtgcc
ggcgctcccgccgccaagcccgccgccgctgctcccgccgccccggctccggctcccgtg
gccgccgccgcggaggcctcggggggctcggatgcccgcatcacgccgacggcccggaag
atggcggaggagaacaagctggacgtctcccagctgaagggcagcggcaccgcgggccgc
atcaccaaggaggacgtgctcggccagctcaaccgcccgaccgcgccctctcagcccgcc
gccccggccacgcccgcgggcccccgccccaacgccgcccgcgaggagcgcgtgcgcatg
acgccgctgcgcaagcgcgtcgcggagcgcctggtccaggcccagtccaccgccgccctg
ctcaccaccttcaacgaggtggacatgggcgaggtgatggccctgcgcaagaagtacaac
gacaagttcctcgcgaagcacggcgtgaagctgggcttcatgagcttcttcgtccgcgcg
tccatcgaagccctcaaggccttcccgcaggtgaacggggagattgacggcgaggacgtc
atcttcaagcactactacgacatcggagtggcggtgagcggcagccgcggcctggtcgtc
cccgtgctgcgcaacgcggacaagctgtccctggcggagctggagaagggcgtcgcggac
ctgggcacccgggctcgcaacgacaagctgggcctggcggacctccagggcggcaccttc
accatcaccaacggcggcatcttcggctccatgctgtccacgcccatcatcaacccgccg
cagacgggcatcctgggcatgcacaacatcgtggagcgccccgtcgtgcgcgacgggcag
attgtcatccgccccatcatgtacgtcgccctcacctacgaccaccggctgattgacggc
cgcgaggccgtccagttcctcgtgcgcgtcaaggagtgcatcgaggacccggagcgtctg
ctgttggacgtctga

DBGET integrated database retrieval system