KEGG   Myxococcus stipitatus: MYSTI_06840Help
Entry
MYSTI_06840       CDS       T02436                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
msd  Myxococcus stipitatus
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:msd00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8800483..8801091)
Genome map
AA seq 202 aa AA seqDB search
MKLYFAPGACSLSPHIVAREAGLDLQFTKVDTQTKVMEGGGDFWKVNPKGYVPALEFEPG
DVLTEGPAIVQYLGDQRPASGLVAPAGTRERYQQQEMLGYINSELHKTYSPLFSPATPEA
TREERKAYLQKRYKLIEERLAGRTYLFGNTFTAADAYLFTVTRWAKFVQLDLSGFPNVLA
FQERVAARPAVREALKAEGLLV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctacttcgctcccggcgcttgctcgctctctccccacatcgtcgcgcgtgag
gcgggcctcgacctgcagttcaccaaggtcgacacgcagacgaaggtgatggagggcggc
ggagacttctggaaggtgaaccccaagggctatgtgcccgccctcgagttcgagcccggc
gacgtgctgaccgaaggtcccgccatcgtccagtacctgggtgaccagcgccccgcgtcc
ggcctggtcgcgcccgccggcacccgcgagcgctatcagcagcaggagatgctgggctac
atcaactccgagctgcacaagacctactcgccgctcttcagccccgcgacgcccgaggcc
acgcgcgaggagcgcaaggcgtacctgcagaagcgctacaagctcatcgaggagcgcctg
gcgggccggacgtacctcttcggcaacacgttcaccgccgcggacgcctacctcttcacg
gtgacgcgctgggcgaagttcgtgcagctggacctgtcgggcttccccaacgtgctcgcg
ttccaggagcgcgtcgccgcgcgtcccgccgtgcgcgaggcgctcaaggcggaaggcctg
ctggtgtga

DBGET integrated database retrieval system