KEGG   Myxococcus stipitatus: MYSTI_07007Help
Entry
MYSTI_07007       CDS       T02436                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
msd  Myxococcus stipitatus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MYSTI_07007
Enzymes [BR:msd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MYSTI_07007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9006070..9006723)
Genome map
AA seq 217 aa AA seqDB search
MSLALRESMIATCRKMNAAGLNQGTSGNLSVRVAGGFLLTPTGMDYDVLVPEDLVLMRMD
GTHEGHRRPSSEWQLHRDILAARPEVGAVLHAHSMFCTTLACLRRGIPAFHYMVSAAGGV
DIRCAPYATFGTGDLARNALHALEGRKACLMANHGMLSLGATLASAFKLAVEVETLAAMY
WRALQVGEPVLLDAEEMERVLEKFKTYGQQSLTPRAG
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgagcctggctttgcgtgagtccatgattgccacctgccggaagatgaacgcggcgggg
ctcaaccaggggacctccggcaacctgagcgtgcgcgtggccggaggcttcctgctcacg
cccaccggcatggactacgacgtgctcgtcccggaggacctcgtcctcatgaggatggac
ggcacgcacgagggacaccgccgtccctcctccgagtggcagctccaccgggacatcctc
gccgcgcgcccggaagtcggcgccgtgctgcacgcccactccatgttctgcaccacgctg
gcctgcctgcgccgaggcatccccgccttccactacatggtctccgccgcgggaggcgtg
gacatccgctgcgccccctacgcgacgttcggcacgggagacctcgcgcgcaacgcactg
cacgccctggagggccgcaaggcctgcctgatggcgaaccacggcatgctgtcgctgggc
gccaccctggccagcgccttcaagctggctgtcgaggtggagaccctcgccgccatgtac
tggcgggcgctccaggtgggagagcccgtgctcctcgacgcggaggagatggagcgcgtg
ctggagaagttcaagacctacggccagcaatccctcacaccgcgcgcagggtga

DBGET integrated database retrieval system