KEGG   Myxococcus stipitatus: MYSTI_07037Help
Entry
MYSTI_07037       CDS       T02436                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
msd  Myxococcus stipitatus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYSTI_07037
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MYSTI_07037
   00630 Glyoxylate and dicarboxylate metabolism
    MYSTI_07037
Enzymes [BR:msd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MYSTI_07037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9048338..9049963
Genome map
AA seq 541 aa AA seqDB search
MTSEAPPSKSPALGAGVAVKGPWHPDYGEVLTPDALAFVARLVRAFGERREGLLERRKAV
QASWRQGARPHFLPETKALREGDWTVAPLPADLQDRRVEITGPVDRKMIINALNSGANVF
MADFEDANSPTWDNVVRGQLNLRDAVRRRISFTAEGGKHYALNDKPAVLFVRPRGWHLPE
RHVEIDGKPISGSLFDFALFFFHNAKEQLARGTGPYFYLPKMQSHLEARLWNDVFVLAQD
TLGIPRGTIKATVLIETLPAAFEMDEILYELREHSAGLNCGRWDYIFSFIKTLQSDTSVV
LPDRGQVTMDKAFLNAYSQLLIQTCHRRHVHAMGGMAAFIPIKGDAAANEAVLEKVRADK
LREVKNGHDGTWVAHPGLVSLARDIFDANMKGANQLSNKREDVRITESDLLKVPSGTRTE
EGLRHNLRVGIQYTAAWLGGLGCVPLYNLMEDAATAEISRAQVWQWLHHGASLEDGRKVT
PELFGTLLREEMARLEKEGVHEKYGAAHVQRARELFEQLSTSPSFEDFLTLPAYEALDST
H
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgacctcggaagcccccccttcgaagagcccggccctcggcgccggcgtggcggtgaag
gggccgtggcaccccgactacggggaggtcctcaccccagacgccctggccttcgtggcc
cggctggtccgcgccttcggggagcgtcgggaagggctgctcgagcgtcgcaaggccgtg
caggcctcctggcgccagggcgcgcgcccccacttcctgccggagacgaaggccctccga
gagggcgactggaccgtggcgccgctgcccgcggacctccaggaccgtcgggtggagatc
accggcccggtggaccggaagatgatcatcaacgccctcaactccggggcgaacgtcttc
atggcggacttcgaggacgccaacagccccacctgggacaacgtcgtccggggccagctc
aacctgcgcgacgccgtccgccgccgcatctccttcaccgccgagggcggcaagcactac
gccctcaacgacaagcccgcggtcctcttcgtgcgcccccgaggctggcacctgcccgag
cgccacgtcgaaatcgacggcaagcccatctccggctcgctcttcgacttcgccctgttc
ttcttccacaacgcgaaggagcagctcgcgcgcggcacgggcccctacttctacctgccc
aagatgcagagccacctggaggcccgcctctggaacgacgtgttcgtgctcgcccaggac
acgctcggcatcccccggggcaccatcaaggccacggtcctcatcgagacgctccccgcc
gccttcgagatggacgaaatcctctacgagctgcgcgagcactccgcgggcctcaactgc
ggccgctgggactacatcttcagcttcatcaagacgctccagtcggacaccagcgtggtg
ctcccggaccggggccaggtgacgatggacaaggcgttcctcaacgcctactcgcagctg
ctcatccagacctgccaccgccgccacgtgcacgcgatgggcggcatggccgcgttcatc
cccatcaagggcgacgccgccgccaacgaggccgtcctggagaaggtccgcgccgacaag
ctgcgcgaggtgaagaacggccatgatggcacctgggtcgcccaccccggcctcgtgtcc
ctggcccgcgacatcttcgacgcgaacatgaagggcgccaaccagctctccaacaagcgc
gaggacgtgcgcatcaccgagtcagacctgctcaaggtcccctccggcactcgcaccgag
gagggcctgcgccacaacctgcgcgtgggcatccagtacaccgccgcgtggctggggggg
ctgggctgcgtgccgctctacaacctgatggaggacgcggccaccgcggagatctcccgc
gcccaggtgtggcagtggctgcaccacggcgcctcgctcgaggacggccgcaaggtgacg
cccgagctgttcggcacgctcctgcgcgaggagatggcccgcctggagaaggagggcgtc
cacgagaagtatggcgccgcccacgtccagcgcgctcgcgagctcttcgagcagctgtcc
acctccccctccttcgaggacttcctcaccctgcccgcctacgaggcgctcgactccact
cactga

DBGET integrated database retrieval system