KEGG   Myxococcus stipitatus: MYSTI_07037Help
Entry
MYSTI_07037       CDS       T02436                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
msd  Myxococcus stipitatus
Pathway
msd00620  Pyruvate metabolism
msd00630  Glyoxylate and dicarboxylate metabolism
msd01100  Metabolic pathways
msd01110  Biosynthesis of secondary metabolites
msd01120  Microbial metabolism in diverse environments
msd01200  Carbon metabolism
Module
msd_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MYSTI_07037
   00630 Glyoxylate and dicarboxylate metabolism
    MYSTI_07037
Enzymes [BR:msd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MYSTI_07037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AGC48309
UniProt: L7UP68
Position
9048338..9049963
Genome map
AA seq 541 aa AA seqDB search
MTSEAPPSKSPALGAGVAVKGPWHPDYGEVLTPDALAFVARLVRAFGERREGLLERRKAV
QASWRQGARPHFLPETKALREGDWTVAPLPADLQDRRVEITGPVDRKMIINALNSGANVF
MADFEDANSPTWDNVVRGQLNLRDAVRRRISFTAEGGKHYALNDKPAVLFVRPRGWHLPE
RHVEIDGKPISGSLFDFALFFFHNAKEQLARGTGPYFYLPKMQSHLEARLWNDVFVLAQD
TLGIPRGTIKATVLIETLPAAFEMDEILYELREHSAGLNCGRWDYIFSFIKTLQSDTSVV
LPDRGQVTMDKAFLNAYSQLLIQTCHRRHVHAMGGMAAFIPIKGDAAANEAVLEKVRADK
LREVKNGHDGTWVAHPGLVSLARDIFDANMKGANQLSNKREDVRITESDLLKVPSGTRTE
EGLRHNLRVGIQYTAAWLGGLGCVPLYNLMEDAATAEISRAQVWQWLHHGASLEDGRKVT
PELFGTLLREEMARLEKEGVHEKYGAAHVQRARELFEQLSTSPSFEDFLTLPAYEALDST
H
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgacctcggaagcccccccttcgaagagcccggccctcggcgccggcgtggcggtgaag
gggccgtggcaccccgactacggggaggtcctcaccccagacgccctggccttcgtggcc
cggctggtccgcgccttcggggagcgtcgggaagggctgctcgagcgtcgcaaggccgtg
caggcctcctggcgccagggcgcgcgcccccacttcctgccggagacgaaggccctccga
gagggcgactggaccgtggcgccgctgcccgcggacctccaggaccgtcgggtggagatc
accggcccggtggaccggaagatgatcatcaacgccctcaactccggggcgaacgtcttc
atggcggacttcgaggacgccaacagccccacctgggacaacgtcgtccggggccagctc
aacctgcgcgacgccgtccgccgccgcatctccttcaccgccgagggcggcaagcactac
gccctcaacgacaagcccgcggtcctcttcgtgcgcccccgaggctggcacctgcccgag
cgccacgtcgaaatcgacggcaagcccatctccggctcgctcttcgacttcgccctgttc
ttcttccacaacgcgaaggagcagctcgcgcgcggcacgggcccctacttctacctgccc
aagatgcagagccacctggaggcccgcctctggaacgacgtgttcgtgctcgcccaggac
acgctcggcatcccccggggcaccatcaaggccacggtcctcatcgagacgctccccgcc
gccttcgagatggacgaaatcctctacgagctgcgcgagcactccgcgggcctcaactgc
ggccgctgggactacatcttcagcttcatcaagacgctccagtcggacaccagcgtggtg
ctcccggaccggggccaggtgacgatggacaaggcgttcctcaacgcctactcgcagctg
ctcatccagacctgccaccgccgccacgtgcacgcgatgggcggcatggccgcgttcatc
cccatcaagggcgacgccgccgccaacgaggccgtcctggagaaggtccgcgccgacaag
ctgcgcgaggtgaagaacggccatgatggcacctgggtcgcccaccccggcctcgtgtcc
ctggcccgcgacatcttcgacgcgaacatgaagggcgccaaccagctctccaacaagcgc
gaggacgtgcgcatcaccgagtcagacctgctcaaggtcccctccggcactcgcaccgag
gagggcctgcgccacaacctgcgcgtgggcatccagtacaccgccgcgtggctggggggg
ctgggctgcgtgccgctctacaacctgatggaggacgcggccaccgcggagatctcccgc
gcccaggtgtggcagtggctgcaccacggcgcctcgctcgaggacggccgcaaggtgacg
cccgagctgttcggcacgctcctgcgcgaggagatggcccgcctggagaaggagggcgtc
cacgagaagtatggcgccgcccacgtccagcgcgctcgcgagctcttcgagcagctgtcc
acctccccctccttcgaggacttcctcaccctgcccgcctacgaggcgctcgactccact
cactga

DBGET integrated database retrieval system