KEGG   Myxococcus stipitatus: MYSTI_07037Help
Entry
MYSTI_07037       CDS       T02436                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
msd  Myxococcus stipitatus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MYSTI_07037
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MYSTI_07037
   00630 Glyoxylate and dicarboxylate metabolism
    MYSTI_07037
Enzymes [BR:msd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MYSTI_07037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9048338..9049963
Genome map
AA seq 541 aa AA seqDB search
MTSEAPPSKSPALGAGVAVKGPWHPDYGEVLTPDALAFVARLVRAFGERREGLLERRKAV
QASWRQGARPHFLPETKALREGDWTVAPLPADLQDRRVEITGPVDRKMIINALNSGANVF
MADFEDANSPTWDNVVRGQLNLRDAVRRRISFTAEGGKHYALNDKPAVLFVRPRGWHLPE
RHVEIDGKPISGSLFDFALFFFHNAKEQLARGTGPYFYLPKMQSHLEARLWNDVFVLAQD
TLGIPRGTIKATVLIETLPAAFEMDEILYELREHSAGLNCGRWDYIFSFIKTLQSDTSVV
LPDRGQVTMDKAFLNAYSQLLIQTCHRRHVHAMGGMAAFIPIKGDAAANEAVLEKVRADK
LREVKNGHDGTWVAHPGLVSLARDIFDANMKGANQLSNKREDVRITESDLLKVPSGTRTE
EGLRHNLRVGIQYTAAWLGGLGCVPLYNLMEDAATAEISRAQVWQWLHHGASLEDGRKVT
PELFGTLLREEMARLEKEGVHEKYGAAHVQRARELFEQLSTSPSFEDFLTLPAYEALDST
H
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgacctcggaagcccccccttcgaagagcccggccctcggcgccggcgtggcggtgaag
gggccgtggcaccccgactacggggaggtcctcaccccagacgccctggccttcgtggcc
cggctggtccgcgccttcggggagcgtcgggaagggctgctcgagcgtcgcaaggccgtg
caggcctcctggcgccagggcgcgcgcccccacttcctgccggagacgaaggccctccga
gagggcgactggaccgtggcgccgctgcccgcggacctccaggaccgtcgggtggagatc
accggcccggtggaccggaagatgatcatcaacgccctcaactccggggcgaacgtcttc
atggcggacttcgaggacgccaacagccccacctgggacaacgtcgtccggggccagctc
aacctgcgcgacgccgtccgccgccgcatctccttcaccgccgagggcggcaagcactac
gccctcaacgacaagcccgcggtcctcttcgtgcgcccccgaggctggcacctgcccgag
cgccacgtcgaaatcgacggcaagcccatctccggctcgctcttcgacttcgccctgttc
ttcttccacaacgcgaaggagcagctcgcgcgcggcacgggcccctacttctacctgccc
aagatgcagagccacctggaggcccgcctctggaacgacgtgttcgtgctcgcccaggac
acgctcggcatcccccggggcaccatcaaggccacggtcctcatcgagacgctccccgcc
gccttcgagatggacgaaatcctctacgagctgcgcgagcactccgcgggcctcaactgc
ggccgctgggactacatcttcagcttcatcaagacgctccagtcggacaccagcgtggtg
ctcccggaccggggccaggtgacgatggacaaggcgttcctcaacgcctactcgcagctg
ctcatccagacctgccaccgccgccacgtgcacgcgatgggcggcatggccgcgttcatc
cccatcaagggcgacgccgccgccaacgaggccgtcctggagaaggtccgcgccgacaag
ctgcgcgaggtgaagaacggccatgatggcacctgggtcgcccaccccggcctcgtgtcc
ctggcccgcgacatcttcgacgcgaacatgaagggcgccaaccagctctccaacaagcgc
gaggacgtgcgcatcaccgagtcagacctgctcaaggtcccctccggcactcgcaccgag
gagggcctgcgccacaacctgcgcgtgggcatccagtacaccgccgcgtggctggggggg
ctgggctgcgtgccgctctacaacctgatggaggacgcggccaccgcggagatctcccgc
gcccaggtgtggcagtggctgcaccacggcgcctcgctcgaggacggccgcaaggtgacg
cccgagctgttcggcacgctcctgcgcgaggagatggcccgcctggagaaggagggcgtc
cacgagaagtatggcgccgcccacgtccagcgcgctcgcgagctcttcgagcagctgtcc
acctccccctccttcgaggacttcctcaccctgcccgcctacgaggcgctcgactccact
cactga

DBGET integrated database retrieval system