KEGG   Myxococcus stipitatus: MYSTI_07073Help
Entry
MYSTI_07073       CDS       T02436                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
msd  Myxococcus stipitatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYSTI_07073
Enzymes [BR:msd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     MYSTI_07073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9088251..9089801
Genome map
AA seq 516 aa AA seqDB search
MSTPGRLSGLLLPLFSLRAPTDFGIGDLGALEGLFTWMKAARQRLLMLLPLLPTAPGDSS
PYATRSAFGLNPLFIDLSALPEFIASGGEAALSAEEKQKLAEARAAPRVRYDLVFPLKDA
ALARAFDTFEARHWAPQSERARAFRQWREAQGDWLEDYALFTAISEQEQRRAWWEWPEPL
RTRKPDALRAKATELERRVRYHAWLQWVAEQQWDAVRAKARAQDVLLCGDEPFIIGQDSA
DCWAYPTILRRDARLGVPPDDFSATGQDWGLPYFDFAAMEKDDYAWLKSRAKKAASYYDL
RRVDHAVGYFRQWIRDEQTPTGRFIPPDEESHRRLGRKHFELLSEGAGIVAEDLGVIPPF
VRSILAELRLPGYRVMRWERDGNDYRHPHHFPPVSLVTTGTHDTDTMAEWWEGARDDERH
AAARAWPEMQGVPVTREFTPEVHRGMLAAALNSSSDLCVLPWQDVLGTRDRINLPGSMSD
SNWAYRISQDAGALMSDSTTREAAEKLAWLTASARR
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtccacccccggccggctgtccggtctcctgctcccgctgttctccctccgcgccccc
acggatttcggcatcggcgaccttggcgcgctggaggggctgttcacctggatgaaggcc
gcccgccagcgcctgctgatgctgctgccgctcctgcccacggcgccgggggactccagt
ccctatgccacccgctccgcgttcggcctcaacccgctcttcatcgacctgagcgcgctg
ccggagttcatcgcctccggaggcgaggccgcgctctccgccgaggagaagcagaagctc
gccgaggcccgcgccgcgccgcgcgtgcgctacgacctggtcttcccgctcaaggacgcg
gccctcgcgcgcgccttcgacacgttcgaggcccggcactgggccccccagtccgagcgc
gcccgcgccttccgccagtggcgagaggcccaaggcgactggctggaggactacgcgctc
ttcaccgccatcagcgagcaggagcagcgccgcgcgtggtgggagtggccggagccgctg
cgcacccgcaagcccgacgccttgcgcgcgaaggccacggaactggagcgccgcgtgcgc
taccacgcctggctccagtgggtggccgagcagcaatgggacgcggtgcgagcgaaggcc
cgcgcccaggacgtgctgctgtgcggcgacgagccgttcatcatcggccaggacagcgcg
gactgctgggcctaccccaccatcctccgccgcgacgcgcggctgggcgtgccgccggac
gacttctccgccacgggccaggactggggcctgccctacttcgacttcgccgcgatggag
aaggacgactacgcgtggctcaagtcgcgcgcgaagaaggcggccagctactacgacctg
cgccgcgtggaccacgcagtgggctacttccggcagtggattcgcgacgagcagacgccc
accgggcgcttcatcccgccggatgaggagagccaccggaggctggggcgcaagcacttc
gagctgctctccgaaggcgccggcatcgtcgccgaggacctgggcgtcatcccacccttc
gtgcggagcatcctcgcggagctccggctgcccggctatcgcgtgatgcgctgggagcgc
gacggcaacgactaccgccacccgcaccacttcccgcccgtgtcgctggtgacgacgggc
acgcatgacacggacaccatggccgagtggtgggagggcgcccgcgacgacgagcgtcac
gccgccgcgcgcgcgtggccggagatgcagggcgtgccggtgacgcgtgagttcaccccc
gaggtccaccggggcatgctggccgcggcgctcaactcgagcagcgacttgtgcgtgctg
ccctggcaggacgtgctggggacccgggaccgcatcaacctgccgggctccatgagcgac
tcgaactgggcctatcgcatcagccaggatgcgggcgcgctgatgtccgactcgacgacg
cgggaggccgcggagaagctggcctggctcaccgcctccgcccgtcgttga

  All links  
No link information was found.   
DBGET integrated database retrieval system