KEGG   Myxococcus stipitatus: MYSTI_07089Help
Entry
MYSTI_07089       CDS       T02436                                 

Definition
(GenBank) 1,4-alpha-glucan branching protein
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
msd  Myxococcus stipitatus
Pathway
msd00500  Starch and sucrose metabolism
msd01100  Metabolic pathways
msd01110  Biosynthesis of secondary metabolites
Module
msd_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MYSTI_07089
Enzymes [BR:msd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MYSTI_07089
Exosome [BR:msd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MYSTI_07089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase CBM_48 Alpha-amylase_C DUF3459 AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: AGC48361
UniProt: L7UH91
Position
9115878..9117839
Genome map
AA seq 653 aa AA seqDB search
MRETKQGEPRRPRKDFSETACEARNNEVVQRTARSRAAPELFGPADQLQVPDFLTAIVPL
EPVPEPSWRPGMGAIPYDGGTTFRVWAPYAQRVQVVGDFSHWHAVELAREPSGNFSRDIA
SAGNGQQYQFIIQGRYGDWRWRNDPRASDVTHSTGNSVILDHRDFVWRFDGLFQMPAPHE
AVIYELHIGTFNDSPGWGPGHWLSAIDKLDYLRELGVNLVELMPSAEFAGDFSWGYNPTF
PFAPESAYGTPNDLKRFVDEAHRRGIGVIMDVVYNHLGPSDLPHWDFDGETLGRGGVYFY
PDWRASTPWGDTRPDYGRSEVRDYLRDNALMWLREYHMDGLRVDATKEIRTASGVDNPAG
WELLRSLTEAVKREFPWKLLIAEDMAANPAVTHPQGAGFDAQWDAAFVHPMRAALIAPFD
EWRDLNAVRDALTFRYNGRSTQRIVYTESHDEVANGRSRLPTEVSPYNPGDVLAKKKALL
GTVLTLTAPGIPMLFMGQEFLEDGHFDDGEPLDWGKAGWFGGILQAHRDLIRLRRNWHDT
TAGLRGEHVHVFHLNHDDKVLAFHRWEDGGPGDDVVVIVNLGHRAFSGYALGLPSDGPWR
VRFNGDWQGYSPDFSGTSVQDVWGEWSGRDGMPASGQLSLGAYSAVILSKDRG
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgcgagagacgaagcagggcgagccacgccggccgcgcaaggacttcagcgagaccgcg
tgcgaggcacgcaacaacgaggtggtgcagcgcaccgcgcgctcgcgggccgcaccggag
ctcttcggccccgccgaccagctccaggtccccgacttcctcaccgccatcgtcccgctg
gagcccgtgccggagccctcctggcgcccgggcatgggcgcgattccctacgacggcggc
accaccttccgggtctgggcgccctatgcgcagcgggtgcaggtggtgggcgacttcagc
cattggcacgcggtggagctcgcccgcgagccgtcgggcaacttctcgcgagacatcgcc
agcgcgggcaacggacagcagtaccagttcatcatccagggccgctatggcgactggcgc
tggcgcaatgacccgcgcgcctccgacgtgacgcactccacgggcaacagcgtcatcctg
gaccaccgggacttcgtctggcgcttcgacggactgttccagatgccggcgccgcacgag
gccgtcatctacgagctgcacatcggcacgttcaacgactcgccgggctgggggccgggc
cattggctgagcgccatcgacaagctcgactacctgcgggagctgggcgtcaacctggtg
gagctgatgccgtcggccgagttcgccggtgacttctcctggggctacaaccccaccttc
cccttcgcgccggagagcgcgtacggcacccccaacgacttgaagcgcttcgtggacgag
gcgcatcgacgcggcatcggcgtcatcatggacgtcgtctacaaccacctgggccccagc
gacctgccgcactgggacttcgacggggagacgctgggccggggcggcgtgtacttctat
ccggactggcgcgcgagcacgccgtggggcgacacgcgcccggactacggccgctccgag
gtgcgcgactacctgcgcgacaacgccctcatgtggctgcgcgagtaccacatggatggg
ctgcgcgtggacgcgacgaaggagattcgcaccgccagcggcgtggacaatcccgcgggt
tgggagctcttgcgctcgctcaccgaggcggtgaagcgcgagttcccgtggaagctcctc
atcgccgaggacatggcggccaaccccgctgtcacccacccgcagggagcgggcttcgat
gcgcagtgggacgcggccttcgtgcacccgatgcgcgccgcgctcatcgcgcccttcgac
gagtggcgcgacctgaacgccgtccgcgacgcgctgaccttccgctacaacggccggagc
acgcagcgcatcgtctacacggagagccacgacgaggtggccaacggccgcagccgactt
cccacggaggtctccccgtacaaccccggtgacgtgctcgcgaagaagaaggccctgctg
ggcacggtgctgacgctcaccgcgccgggcatccccatgctcttcatggggcaggagttc
ctggaggacgggcacttcgacgacggcgagccgctcgactggggcaaggccgggtggttc
ggcggaatcctccaggcccaccgggacctcatccggctgcgccgcaactggcacgacacc
accgcgggcctgcgcggcgagcacgtccacgtcttccacctcaaccacgacgacaaggtg
ctggccttccaccgctgggaggacggcgggccgggtgacgacgtggtggtcatcgtgaac
ctgggccaccgcgccttctccgggtacgcgctgggcctgccctcggatggcccgtggcgg
gtgcgcttcaacggggactggcagggctactcgccggacttcagcggcacctccgtccag
gacgtctggggggaatggagcggacgggatggcatgcccgcgagcggccagttatctcta
ggggcatacagcgcggtcatcctctcgaaggaccgcggctga

DBGET integrated database retrieval system