KEGG   Myxococcus stipitatus: MYSTI_07205Help
Entry
MYSTI_07205       CDS       T02436                                 

Definition
beta-galactosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
msd  Myxococcus stipitatus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MYSTI_07205
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    MYSTI_07205
Enzymes [BR:msd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MYSTI_07205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9256211..9257371
Genome map
AA seq 386 aa AA seqDB search
MWSENSVQSGPRFCETAPVTTSALYRDCARLFMVGFPGTRIDADFAALMDDGIYGAILFK
RNVGTAQETAALCREVKTRAGRPFILSVDQEGGRVARLRGAPFTTLPSMRELGQRGDVQH
LERVGRLLAHELRAVGFDWDFAPVLDVDTNPANPVIGDRSPSREAHEVARLGVALARGLE
AGGVASCGKHFPGHGDTTTDSHLTLPRLTHDLERLRQVELVPFRAFAQARLASVMTAHVM
FDALDKDVPATMSERVLARVLREELGFDGVLVSDDLEMKAIADHYTVEEAAVRGTLAGVD
LFLVCHHADVQRRAIEAVVKAVESGRIPRERIQEAHRRLEVLSARFAHPAEDRLATLGSA
EHQELAKGLDSAFVGKDPTEVMVAAR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtggtcagagaactccgtccagtccggccccaggttctgcgagactgcgcccgtgacc
acctccgccctctaccgtgactgcgcccgcctcttcatggtgggctttcctgggactcgc
atcgacgccgacttcgcggcgctgatggatgacggcatctatggcgccatcctcttcaag
cgcaacgtggggacggcccaggagaccgccgcgctgtgccgggaggtgaagacgcgtgcg
ggccggcccttcatcctctcggtggaccaggagggtggacgggtggctcggctgcgcggc
gcgcccttcacgacgctgccgtccatgcgcgagctgggacagcgcggtgatgtccagcac
ctggagcgcgtggggcggctgctcgcgcacgagctgcgcgcggtgggcttcgattgggac
ttcgcgccggtgctggatgtggacaccaatcccgccaacccggtgattggagaccggagc
cccagccgcgaggcgcacgaggtggcacgcctgggtgtggcgctcgcgcgagggctggag
gcgggtggggtcgcgtcctgcggcaagcacttcccggggcatggggatacgacgacggac
agccacctgacgctgcctcggctgacgcatgacctggagcggctgcggcaggtggagctg
gtgcccttccgggcgttcgcccaggcgcggctggcgtcggtgatgacggcgcacgtgatg
ttcgacgcgctggacaaggacgtgcccgcgacgatgagcgagcgcgtgctggcgcgggtg
ctgcgcgaggagctggggttcgacggcgtgctggtgagtgatgacctggagatgaaggcc
atcgcggaccactacacggtggaggaggcggcggtgcgcggcacgctggcgggcgtggac
ctgttcctcgtgtgccaccacgcggacgtgcagcgtcgcgccatcgaggcggtggtgaag
gcggtggagtccggccgcatcccgcgcgagcgcatccaggaggcgcaccgcaggctcgag
gtgctctcggcgcgcttcgcgcatcccgcggaggaccgcctcgcgacgctggggagcgcg
gagcaccaggagctcgccaaggggctcgacagcgcgttcgtgggcaaggacccgaccgag
gtcatggtcgcggctcgctga

DBGET integrated database retrieval system