KEGG   Myxococcus stipitatus: MYSTI_07374Help
Entry
MYSTI_07374       CDS       T02436                                 

Definition
alpha/beta fold family hydrolase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
msd  Myxococcus stipitatus
Brite
Enzymes [BR:msd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     MYSTI_07374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9452172..9452993
Genome map
AA seq 273 aa AA seqDB search
MMDARLAMDEEKTGAFELGHGPDACLVLHGFTGSPWDVRPLAEALAARGMRVVAPLLPGH
GATPQALLGVTWRDWRDEARRALDLLRGHRQVFVAGLSMGALLAVGLAADAPARVRGLVL
AAPALRFRGARMRVIRQLSRTPLLEWVHPWVAKSSTDISDPAVLAMAPILSGFPVARLRD
VVTLQDAAARSAARVRCPVLIAVAEQDHVVDPRGGLELARRLKASPCVRVLSLQRGFHII
PRDTDGPRLAREACDFLTHVCNFGEWEPQSAGT
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgcgcgcttggccatggatgaggagaagacaggggcgttcgagctggggcac
ggtcccgatgcgtgtctggtgctgcacggcttcaccggcagtccctgggatgtgcggccg
ttggccgaggccctggccgcgcgaggaatgcgcgtcgtggccccgctcctgcccggacat
ggcgccacgccccaggcgctgctgggggtcacctggcgcgactggcgggacgaggcccgg
cgcgcgctcgacctgctgcggggccaccggcaggtcttcgtcgcgggcctgtccatgggc
gcgctgctcgcggtgggcctggccgcggatgcgcccgcgagggtgcgcggactggtgctc
gccgcgccggccctgcgctttcgaggagcacgcatgcgcgtcatccgtcagctgtcgcgc
acgccgctgctcgagtgggtgcacccgtgggtggcgaagtcgagcacggacatctcggac
ccggcggtcctggccatggcgcccatcctctccgggttccccgtggcgaggctccgggac
gtcgtcaccttgcaggacgccgcggcccggagcgccgcgcgcgtgcggtgccctgtcctc
atcgccgtggcggagcaggaccatgtcgtggacccacgaggagggctggagctggcgcgg
cggctcaaggcgtccccgtgcgtgcgcgtcctctcgctccagcgaggattccacatcatc
cctcgcgacacggacgggccgcgcctcgcgagggaggcctgcgactttttgacgcacgtc
tgtaactttggagaatgggagccacaatccgcgggcacctga

DBGET integrated database retrieval system