KEGG   Myxococcus stipitatus: MYSTI_07381Help
Entry
MYSTI_07381       CDS       T02436                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
msd  Myxococcus stipitatus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MYSTI_07381
Enzymes [BR:msd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MYSTI_07381
Exosome [BR:msd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MYSTI_07381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9461784..9463274
Genome map
AA seq 496 aa AA seqDB search
MPKAKYVLALDQGTTGTHVSILDSKLKVVGRSYKEFTQHFPKPSWVEHDLDEIWSTSEWC
IARALKDAGLHGRDISAVGITNQRETTGLWSRDSGKPLHRAIVWQDRRTSEMCRRLKERG
VEPRVRDITGLVVDPYFSGTKLTWFFEHLKGARARAERGDVCFGTIDTWLVYKLTGGTAH
VTDVSNASRTMLMDLKTLQWSDEMRSLLSVPGACLPQIRGSAEVYGTTRGMRSLPDGVPV
AGMAGDQQAALFGQACFEPGESKCTYGTGAFLLMNTGTAPVRSSAGLLTTVAWRLGGTGS
TTYALEGSSFIAGAAVQWLRDGLKIIKRAPDIEALAASVKDSGDVVFVPALAGLGAPHWR
PEARGLFAGMDRSTTVAHMARAVLEGIALQIHDLAEAMRRDSGRDIPVFKADGGAAANNL
LMQYQADLLGVPVVRPRNLETTSLGAAFLGGLGAGVWDSPDAIRRAWKADKVFKPKMKAD
ARERHLSKWKRAVERA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaggcgaagtacgtcctggccctggaccagggcaccactggcacccacgtctcc
atcctcgactcgaagctcaaggtggtgggccgctcctacaaggagttcacccagcacttc
cccaagccgtcctgggtggagcacgacctggatgaaatctggagcacgagcgagtggtgt
atcgcccgcgcgctgaaggacgccgggctgcacggccgggacatctccgcggtgggcatc
accaaccagcgcgagacgacgggcctgtggtctcgggacagcggcaagcccctgcaccgc
gccatcgtctggcaggaccgccgcacgtcggagatgtgccgccggctcaaggagcgcggc
gtggagcctcgcgtgcgggacatcaccgggctggtggtggacccatacttctccggcacc
aagctcacctggttcttcgagcacctgaagggtgcccgcgcgcgcgccgagcggggggac
gtgtgcttcggaaccatcgacacgtggctcgtctacaagctcacgggtggcacggcgcac
gtcacggacgtgtccaatgccagccgcacgatgttgatggacttgaagacgctccagtgg
agcgatgagatgcgctcgctcctgtcggtaccgggggcgtgcctgccgcagattcgcggc
tcggcggaggtgtacggcaccacgcgaggcatgcgcagcctgccggacggtgtccccgtc
gcgggcatggcgggcgaccagcaggcggccctcttcggtcaggcgtgcttcgagcccggc
gagtccaagtgtacgtacggcacgggggcgttcctgttgatgaacacgggcacggcgccg
gtgcgttcgtcggcgggcctgctgaccacggtggcgtggcggctgggcggcacgggctcc
acgacgtatgcgctggaggggagcagcttcatcgccggggccgcggtgcagtggctgcgg
gatgggctgaagatcatcaagcgcgcgccggatatcgaagcgctcgctgcgagcgtgaag
gactcgggtgacgtggtgttcgtgccggcgctcgcgggcctgggagcgccgcactggcgt
cccgaggcgcggggcttgttcgcgggcatggaccgctccaccacggtggcgcacatggcg
cgcgcggtgctggagggcatcgcgctgcagattcacgacctggcggaggcgatgcgccgc
gacagcggacgagacatccccgtgttcaaggcggacggcggcgcggcggccaacaacttg
ctgatgcagtaccaggcggacctgctgggagtccccgtggtgcgcccgcgcaacctggag
acgaccagcctgggcgcggcgttcctggggggcctgggcgcgggtgtctgggacagcccg
gacgccatccgccgcgcgtggaaggcggacaaggtcttcaagccgaagatgaaggccgat
gcgcgcgagcgacacctgagcaaatggaagcgcgcggtggagcgggcgtag

DBGET integrated database retrieval system