KEGG   Myxococcus stipitatus: MYSTI_07387Help
Entry
MYSTI_07387       CDS       T02436                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
msd  Myxococcus stipitatus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:msd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MYSTI_07387
  Amino acid metabolism
   00300 Lysine biosynthesis
    MYSTI_07387
Enzymes [BR:msd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     MYSTI_07387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9468200..9469285)
Genome map
AA seq 361 aa AA seqDB search
MSSSQDLATRLARTTLELCRISSPITQEGPIADFTERWALQHFPAKDVCRVGHTLLLGNL
DDPRPTVALIGHLDTVPAHPSDQGRVPRIEGERVFGLGASDMKGGLAVMMALAEDLRRDT
LPVNLAFLFYEREEGAYAESGLIPLFAKRPDLARVKFGIAMEPTDSEVQVGCVGSMQATV
RFTGRSAHSARPWQGENAIHKAGPFLAELLAKQRVEVDVDGFRFYEVINATLAKGGRARN
VIPEAFELNLNYRFAPGKSIEQAKADVHALVAGRAEVEISDASPSGPVVSGNPLFQKLLA
ITGLPAASKQAWTDVARFGEWGVDAINYGPGETAQAHQANESAPIAPLAVAYEKLAAFLK
G
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcctctcaagacctcgccacgaggctcgcccgtacgacgctcgagctgtgccgt
atctccagccccatcacccaggaaggccccatcgccgacttcaccgagcggtgggcgctc
cagcacttcccagcgaaggacgtctgccgggtcgggcacacgctgctcttggggaacctg
gacgaccctcggcccacggtggcgctcatcgggcatctggacacggtgcccgcgcacccg
agcgaccaggggcgcgtgcctcgcatcgagggtgagcgcgtcttcgggttgggtgcgtcg
gacatgaagggcgggctggcggtgatgatggcgctggcggaggaccttcgccgcgacacg
ttgccggtgaacctggcgttcttgttctacgagcgggaggagggggcgtatgcggagagc
ggcttgattccgctcttcgcgaagcgaccggacctggcccgcgtgaagttcggcatcgcg
atggagcccacggacagcgaagtccaggtggggtgcgtgggctcgatgcaggcgacggtc
cgcttcacggggcgcagcgcgcactcggcgcggccgtggcagggggagaacgccatccac
aaggcgggcccgttcctggcggagttgttggcgaagcagcgggtggaggtggatgtcgac
ggcttccgcttctacgaggtcatcaacgcgacgctggcgaagggggggcgcgcgcggaac
gtgattcccgaggcgttcgagctgaacctcaactatcgcttcgcgccggggaagagcatc
gagcaggcgaaggcggacgtgcacgcgctggtggcgggccgcgcggaggtggagatctcc
gacgcgtcgcccagcgggccggtggtctccggcaacccgctgttccagaagctgctggcc
atcacggggttgcccgcggcctcgaagcaggcgtggacggatgtggcgcgcttcggggag
tggggcgtggacgccatcaactacggccccggtgagacggcgcaggcgcaccaggcgaac
gagagcgcgcccatcgctccgctggccgtggcgtacgagaagctggccgcgttcctcaag
gggtga

DBGET integrated database retrieval system