KEGG   Myxococcus stipitatus: MYSTI_07594Help
Entry
MYSTI_07594       CDS       T02436                                 

Definition
di-heme cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
msd  Myxococcus stipitatus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9712125..9713267)
Genome map
AA seq 380 aa AA seqDB search
MSPVWKVSAVAAAVVAAGCGDSGPEQPAPPAYVWDLPAGFPEPFVPETNPMSEAKVELGR
HLFFDKRLSGNGTMACGSCHEQARAFSDGKATPVGSTGDAVPRNAPGLANVAYLDTYTWA
NPLLTTLESQALVPLFGEHPTELGLTSRLEEVLQRFREDARYPELFRKAFPNDADPVSRE
SIAKALASFQRTLLSGGSPYDRYLQGESSALSASARRGMELFFGERAECYHCHSGRHLSN
SFRSKDSKPQPPQFFNTGLYDLNGKGAYPPQNPGLYEFTHDVLDQGRFRVPQLRNAELTA
PYMHDGSIPTLEAVIEHYMAGGRNVVEGPYAGDGRLNPNKDPLVRPFELSDSEKGDLVAF
LKSLTDTAFLTDPRFSNPWE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcctgtgtggaaggtgagtgcggtggcggctgccgtggtggccgccggatgtggg
gacagtgggccagagcagccggcgccaccggcgtatgtgtgggacctgcccgcggggttc
cccgagccttttgttcccgagaccaaccccatgtccgaggccaaggtggagctggggcgc
cacctcttcttcgacaagcggctgtcgggcaacggcaccatggcatgcggaagctgtcac
gagcaggcgcgagccttttcggatggcaaggcgacacccgtggggtccacgggagatgcg
gtcccccgcaacgcgccagggctggcgaacgtggcctatctggacacgtacacctgggcg
aacccgttgctgacgacgctggagtcgcaggccctggtgccactgttcggcgagcacccc
acggagctggggctgacgtcccggctggaggaggtgctccagcggttccgggaggatgcc
cggtatcccgagctgttccgcaaggcgttcccgaacgatgcggacccggtgagtcgcgag
tccatcgcgaaggcgctggcgtccttccagcgcacgctgctgtcgggtggctccccctat
gaccgctatcttcagggagagagctcggcgctgtccgcgtcggctcgtcgggggatggag
ttgttctttggtgaacgggccgagtgctatcactgccacagtggacggcatctctcgaac
tcgttccggtcgaaggactcgaagccgcagccgccgcagttcttcaacacgggtctgtac
gacttgaatgggaagggggcctaccctccgcagaacccgggcctctatgagttcacccat
gacgtgctggaccaggggcgcttccgggtgccgcagctgcgcaacgcggaattgacggcg
ccgtacatgcacgacggcagcatccccacgctcgaggcggtcatcgagcactacatggcg
ggtggacgcaacgtggtggagggcccgtatgcgggcgacgggcggctcaatcccaacaag
gacccgctggtgcggcccttcgagttgtccgactcggagaagggcgaccttgtcgccttc
ctgaagagcctcacggacacggcgttcttgaccgacccgcgcttctccaatccatgggag
tga

DBGET integrated database retrieval system