KEGG   Myxococcus stipitatus: MYSTI_07850Help
Entry
MYSTI_07850       CDS       T02436                                 

Definition
di-heme cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
msd  Myxococcus stipitatus
Brite
Enzymes [BR:msd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     MYSTI_07850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10009194..10010354
Genome map
AA seq 386 aa AA seqDB search
MIPRSWCVAALALSLGGMGLACESEEPFPTLDELDQLRSLHSLSSHPRLDSTNRVDGQEV
AQKLGFDLFRDPGLSRCGTVSCESCHTGDGRTVETATAEGCGGQRTERNPPTVLNVRHNR
WFMWDGRADSLWSQAMLPLMNPVEMDSNADIVRARLVAEPSYQERYRTLFGTEPASVAAP
LLMANVGKVLAAYERVLMRVEAPFDTDVRRFIAAAEAGSAESDPAYLGLKTFVRKGQCIV
CHKGPSLTDELFHNVGLEDSGPGAGGQWAVLNSLLDWEFNAAGRYSDDPNGTDAQRLRTL
RTQAKQVELEGAFRTPSLRNVALTAPYMHTGKETTLEDVIDFYNEGGDPEGTFVGQRTST
IVKLDLTDNEKRALVELLKSLTGTPR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgattccaagaagctggtgtgtcgcggcgctcgccctgagtctgggcgggatgggactc
gcatgcgaatccgaggagcccttccccaccctcgacgagctggaccaactgcgcagcctc
cactccctgtcgagccaccctcggctggactccaccaaccgggtggacggccaggaggtg
gcgcagaagctgggcttcgacttgttccgggacccggggctgtcgcgctgcgggacggtg
tcctgcgagagctgccacacgggtgacggccgcacggtggagacggccacggcggagggc
tgcggaggccagcgcaccgagcgcaacccgcccacggtgctcaacgtgcggcacaaccgc
tggttcatgtgggacgggcgcgcggactcgctctggtcccaggcgatgctgccgctgatg
aacccggtggagatggactcgaacgcggacatcgtccgcgcgcgactcgtcgcggagccg
tcgtaccaggagcggtaccggacgctgttcggcacggagcccgcgagcgtggcggccccg
ctgctgatggccaacgtgggcaaggtgctggccgcgtacgagcgcgtgctgatgcgggtg
gaggccccgttcgacacggacgtgcggcgcttcatcgccgcggcggaggcgggctcggcg
gagagcgacccggcgtacctggggctgaagaccttcgtgcgcaaggggcagtgcatcgtc
tgccacaagggcccatcgctgacggacgagctgttccacaacgtgggcctggaggactcg
gggcccggcgcggggggacagtgggcggtgctcaactcgctgctggactgggagttcaac
gccgcgggccgctacagcgacgacccgaacggcacggacgcgcagcgcctgcgcacgctg
cgcacgcaggcgaagcaggtggagctcgagggggcgttccgcacgccgtccctgcgcaac
gtggcgctgacggcgccgtacatgcacaccgggaaggagacgacgctcgaggacgtcatc
gacttctacaacgagggcggcgacccggagggcaccttcgtgggccagcgcacctccacc
atcgtcaagctggacctcaccgacaacgagaagcgcgccctggtggagctcttgaagtcg
ctgacggggacgcctcgctga

DBGET integrated database retrieval system