KEGG   Metallosphaera sedula: Msed_0185Help
Entry
Msed_0185         CDS       T00509                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mse  Metallosphaera sedula
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mse00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Msed_0185
Enzymes [BR:mse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Msed_0185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
149378..150253
Genome map
AA seq 291 aa AA seqDB search
MITVVGSYNLDMTFKLNHFPIPGETVFAQEVRVGHGGKGSNQAVSASRLGARARFVGAVG
NDANGKNAINFLSSEGVDTSCVRVKNAHTGSAYILLNGGGETMIVVNRGANYELTPEDLD
GCLEGKVLLTQLEIREDVVKRALSGFSGIRILNPAPAELNDVEILNYVDILTPNEVEFQE
ISNSDDMSYGAQILLKRVKRAVIVTLGENGAIIYTKSKSVRIPTIKVNPVDTTGAGDVFN
AALAVFLERDYDLETAVEKANIIASYSVTTYGALGPTWKEIKEKYPEIPLP
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
ttgataaccgtagtgggaagttataaccttgatatgacgttcaagctcaatcactttcct
atacctggagagacagtatttgctcaggaagtcagagtaggtcatgggggaaagggctcc
aatcaagcagtctcagcttctagattgggagcaagagcgaggttcgtaggcgcagtcgga
aatgacgcgaatggtaaaaatgcgataaactttctcagctctgagggcgtggatacctca
tgtgtaagggtgaagaatgcccataccggatcggcttacatcttactcaatggtggtgga
gagactatgatagtggtgaaccgaggggcaaactacgaattaaccccagaggacctagac
gggtgtctagaggggaaagtattgctcactcagctcgagatcagggaagatgtggtgaag
agggcactgtcagggttttccggtatcaggattttgaaccccgctcccgcagagttaaat
gatgttgaaatactcaattatgtggatatattaacccccaatgaggttgagttccaggag
atcagtaattcagatgatatgtcgtatggagcacagatattgctaaagagggtcaaacgt
gctgtgatagtgactcttggagaaaacggtgcaataatctataccaagagcaagtcggtg
aggatacccacaatcaaggtaaaccccgtggataccactggcgcaggcgacgtctttaat
gcagctttggcggttttccttgaaagggattacgacctggagaccgcggttgaaaaggca
aacattatagcctcgtactcagttaccacttatggagcgcttggaccaacgtggaaagag
atcaaggaaaagtacccggaaatcccactcccatga

DBGET integrated database retrieval system