KEGG   Metallosphaera sedula: Msed_0218Help
Entry
Msed_0218         CDS       T00509                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mse  Metallosphaera sedula
Pathway
mse00860  Porphyrin and chlorophyll metabolism
mse01100  Metabolic pathways
mse01110  Biosynthesis of secondary metabolites
mse01120  Microbial metabolism in diverse environments
Module
mse_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mse00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Msed_0218
Enzymes [BR:mse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Msed_0218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 GARS_N Methyltransf_8
Motif
Other DBs
NCBI-ProteinID: ABP94395
UniProt: A4YD93
Position
179798..180472
Genome map
AA seq 224 aa AA seqDB search
MRVLYLRPEGSSLPELPGFSILNVSIFSVKCLEYDNSYLKSDGVAFTSVNAVRCFKDFDS
IRGKSIFSIGPGTAEELRKHGFESIYPERYTSKDLALLILRSGVREVSAFRSLKASDDMR
RILVSILYHEVYDYDLILDEEKLNQVKELLATCSVDVVVLTSSLIAKSVANFIRDCHKVV
TIGPMTSASLKTLRPDLSFTESDESTIDGTVKVLKSLKGGERDG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcttataccttagacctgaggggagttcgttaccagagcttccagggtttagt
atcctcaacgtctctattttctccgtaaagtgcctcgagtatgacaactcgtatctgaag
agtgacggagttgcgtttactagcgtaaacgcggtaagatgcttcaaggactttgatagt
atacggggaaaaagtatattttccataggtccggggacggctgaggagttaaggaagcat
gggttcgaatcgatctatccagaaaggtatactagcaaggatctagctctcctgatcctc
aggagtggcgttcgcgaggtttctgccttcaggagcctcaaggcatcagatgatatgagg
aggatactagtctctatcctatatcatgaagtatacgactacgatctaatcttagatgaa
gagaagctaaaccaagttaaggaacttctcgctacgtgttccgtggatgttgtggtgctg
acgagttcattaatagctaaaagtgtagctaatttcataagggattgtcataaagtagtt
accataggaccaatgacatctgcttcactgaaaacacttagaccggacttgagtttcact
gaaagcgacgagtccacaatagatgggaccgttaaggttttgaagagtttgaaaggaggt
gaaagagatggatga

DBGET integrated database retrieval system