KEGG   Metallosphaera sedula: Msed_0218Help
Entry
Msed_0218         CDS       T00509                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mse  Metallosphaera sedula
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mse00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Msed_0218
Enzymes [BR:mse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Msed_0218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
179798..180472
Genome map
AA seq 224 aa AA seqDB search
MRVLYLRPEGSSLPELPGFSILNVSIFSVKCLEYDNSYLKSDGVAFTSVNAVRCFKDFDS
IRGKSIFSIGPGTAEELRKHGFESIYPERYTSKDLALLILRSGVREVSAFRSLKASDDMR
RILVSILYHEVYDYDLILDEEKLNQVKELLATCSVDVVVLTSSLIAKSVANFIRDCHKVV
TIGPMTSASLKTLRPDLSFTESDESTIDGTVKVLKSLKGGERDG
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcttataccttagacctgaggggagttcgttaccagagcttccagggtttagt
atcctcaacgtctctattttctccgtaaagtgcctcgagtatgacaactcgtatctgaag
agtgacggagttgcgtttactagcgtaaacgcggtaagatgcttcaaggactttgatagt
atacggggaaaaagtatattttccataggtccggggacggctgaggagttaaggaagcat
gggttcgaatcgatctatccagaaaggtatactagcaaggatctagctctcctgatcctc
aggagtggcgttcgcgaggtttctgccttcaggagcctcaaggcatcagatgatatgagg
aggatactagtctctatcctatatcatgaagtatacgactacgatctaatcttagatgaa
gagaagctaaaccaagttaaggaacttctcgctacgtgttccgtggatgttgtggtgctg
acgagttcattaatagctaaaagtgtagctaatttcataagggattgtcataaagtagtt
accataggaccaatgacatctgcttcactgaaaacacttagaccggacttgagtttcact
gaaagcgacgagtccacaatagatgggaccgttaaggttttgaagagtttgaaaggaggt
gaaagagatggatga

DBGET integrated database retrieval system