KEGG   Metallosphaera sedula: Msed_0308Help
Entry
Msed_0308         CDS       T00509                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mse  Metallosphaera sedula
Pathway
mse00010  Glycolysis / Gluconeogenesis
mse00020  Citrate cycle (TCA cycle)
mse00620  Pyruvate metabolism
mse00633  Nitrotoluene degradation
mse00640  Propanoate metabolism
mse00650  Butanoate metabolism
mse00680  Methane metabolism
mse00720  Carbon fixation pathways in prokaryotes
mse01100  Metabolic pathways
mse01120  Microbial metabolism in diverse environments
mse01130  Biosynthesis of antibiotics
mse01200  Carbon metabolism
Module
mse_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mse_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:mse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msed_0308
   00020 Citrate cycle (TCA cycle)
    Msed_0308
   00620 Pyruvate metabolism
    Msed_0308
   00640 Propanoate metabolism
    Msed_0308
   00650 Butanoate metabolism
    Msed_0308
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Msed_0308
   00680 Methane metabolism
    Msed_0308
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Msed_0308
Enzymes [BR:mse01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Msed_0308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N SHOCT
Motif
Other DBs
NCBI-ProteinID: ABP94485
UniProt: A4YDI3
Position
264405..265601
Genome map
AA seq 398 aa AA seqDB search
MMKIISGNEAVALAVKLARVGVVGIYPITPQTTIIEELAEMRARGEISTDVVRVESEHSA
MGVTLGAAVSGVRAFTATSSQGLLYMHEMVWWAAGSRAPIVMVVATRAVGAPWNIWNENT
DFMSERDSGWIMAFASSPQEALDLTLQAFRISEDPRVFVPMMVGMDGFILSHTKTNVYIP
SQEDVDAFIPPRRQPYVIDPETQESMGNIFQPVHYMKLRQSINDAIADSKDVIREVGREY
EKINPLADYKTLNVEYKLEDADYAVVTMGAWSLDAMEAVDRLRERGISVGLYRVRYVRPW
AEDEILRALGDKKGVIVFDRATSLGRGGPLYLEVKASLNNPVKGVVAGLGGVSMNKRDFM
EAISTSIEEMKRGSFREVTWYYPSEVKEVELGTPRSAI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagattatttcagggaatgaggctgttgccctcgcggtaaagctagcgagggtt
ggggttgtggggatctacccaataactcctcagaccaccataatcgaggaactggctgag
atgagggcaaggggggagatctccacagatgtggttagggtggagagcgaacactctgcc
atgggtgtaaccctgggggcagccgtgtctggagtaagggcgttcactgctacctcctcc
cagggacttctttacatgcacgagatggtttggtgggctgcagggagcagggcacccata
gtgatggtggtagcaactagggcagtgggtgctccttggaacatctggaacgagaacact
gacttcatgagtgagagggatagtggttggataatggccttcgcctcaagccctcaggag
gcgcttgatctaaccctgcaggccttcaggatctccgaggatcctagggttttcgttccc
atgatggtgggaatggatgggttcattctctcccataccaagaccaacgtgtatattcct
tcgcaggaggatgtagacgcatttattccgcccaggaggcaaccctacgttatagatccg
gaaacgcaggagagcatgggtaacattttccaaccagtccattacatgaagctaaggcag
tccataaatgatgccatagcggactcgaaggacgtgattagggaagtcggaagggaatac
gagaagataaaccccctagcggattacaagaccctcaacgtagagtataagctagaggat
gccgactacgccgtggttaccatgggggcttggtccttagacgcgatggaggctgtggac
aggttaagggagagaggaatctccgtgggactttatagggtgagatacgtgagaccgtgg
gctgaagacgagatattaagggcactgggagataagaagggagttattgtgtttgacagg
gcgacgtcgctgggcagaggagggcctctttacctggaagtgaaggcgtccctgaataac
cccgtaaagggggtagttgcaggactgggaggtgtgtccatgaacaagagggatttcatg
gaggccatatccacgtccatcgaggaaatgaagcgtggctcctttagggaggtaacctgg
tactatccgagcgaggtgaaagaagttgagcttgggactccgaggtctgcgatctga

DBGET integrated database retrieval system