KEGG   Metallosphaera sedula: Msed_0309Help
Entry
Msed_0309         CDS       T00509                                 

Definition
pyruvate ferredoxin oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
mse  Metallosphaera sedula
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:mse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msed_0309
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msed_0309
   00020 Citrate cycle (TCA cycle)
    Msed_0309
   00620 Pyruvate metabolism
    Msed_0309
   00640 Propanoate metabolism
    Msed_0309
   00650 Butanoate metabolism
    Msed_0309
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Msed_0309
   00680 Methane metabolism
    Msed_0309
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Msed_0309
Enzymes [BR:mse01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Msed_0309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
265576..266454
Genome map
AA seq 292 aa AA seqDB search
MGLRGLRSESLLPGTSACPGCPENMAMRMVGMALGKNVAMVVVAGCSSVIQGIGPKNAYG
YPVLNIAFAAGPAAASGMWRAFKQRNKDVTVVVWAGDGGTADIGFASLSGAAERNEDFIY
LCVDNEAYMNSGGQRSGSTPHGAVTTTTPEGKKENKKELLFIMLDHNVPYVATASVGYPH
DLMDKLKRAKEVNGFRYIQILTPDPYGWLFDPSKTAEVGKLAVQTCYWPLIEVMNGKVRV
SNESLHCLKKETRRPLKDFLSVQGRYKKLPERDYLELEKFVDDLWERIISMS
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgggactccgaggtctgcgatctgagtcactccttccagggacgtcagcctgccctgga
tgtcctgagaacatggccatgagaatggtgggaatggccctgggtaagaacgttgccatg
gttgtagtggcagggtgttcctccgtaattcaggggatagggcccaagaacgcttacggc
tatcctgtgcttaatatagccttcgctgccggtcccgcagcagcctcaggtatgtggagg
gccttcaaacagaggaacaaggacgtgactgtggtggtctgggctggagatggaggtaca
gcggacatagggtttgcatcacttagcggagctgctgagaggaacgaggacttcatatac
ctctgtgtggacaatgaggcctacatgaactccggaggtcagaggagcggttccaccccc
cacggtgccgtaaccactaccacacctgaagggaagaaggagaacaagaaggagttactc
ttcataatgcttgaccataacgttccctatgtggccacggcatccgtgggctatccccat
gacctcatggataagttgaagagggccaaggaagtgaacggatttaggtatatccagatc
cttacaccagacccttatggttggctatttgatccctctaagaccgctgaggttggcaag
ttggctgtgcagacgtgttattggcccctcatagaggttatgaacgggaaggttagggta
agtaatgagtcgctccattgccttaagaaggagaccagaaggcccttgaaggacttcctt
tctgttcagggcaggtacaagaagctcccggaaagggattacctggaactagagaagttc
gtggatgacctctgggaaaggataatctccatgagctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system