KEGG   Metallosphaera sedula: Msed_0398Help
Entry
Msed_0398         CDS       T00509                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
mse  Metallosphaera sedula
Pathway
mse00010  Glycolysis / Gluconeogenesis
mse00071  Fatty acid degradation
mse00350  Tyrosine metabolism
mse00625  Chloroalkane and chloroalkene degradation
mse00626  Naphthalene degradation
mse01100  Metabolic pathways
mse01110  Biosynthesis of secondary metabolites
mse01120  Microbial metabolism in diverse environments
mse01130  Biosynthesis of antibiotics
mse01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msed_0398
  Lipid metabolism
   00071 Fatty acid degradation
    Msed_0398
  Amino acid metabolism
   00350 Tyrosine metabolism
    Msed_0398
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Msed_0398
   00626 Naphthalene degradation
    Msed_0398
Enzymes [BR:mse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Msed_0398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 NAD_binding_7 AlaDh_PNT_C DapB_N Epimerase KR adh_short ELFV_dehydrog NADH_4Fe-4S NAD_binding_3 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ABP94575
UniProt: A4YDS3
Position
complement(347308..348255)
Genome map
AA seq 315 aa AA seqDB search
MRAFAAVLERFSEPLVLREADVGEGLPVKVKASGMCGRDLVIWRGGFRNLTPPLILGHEI
YGEYEGNPVGVYGVETCGECRYCRAGKENLCENARFLGEARPGGYAEVVTVKEGGIFPLP
DREYEKYAAGVCPLATAIHSSKVAGVKKGDTVLVTGAGGGVGIHTIQYLKSLGARVVSVT
SPSKSEIVSRFSDQVITQKDFSKQVKDVDVVIELVGSETINESLRALRREGTLVLVGNVT
GKEISLARPALTIMREHRIVGSASYTRAEVEEAVKLIHEGEVKPVYRKYHLREVNTAMKD
LMEGKVLGRAVLVTG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagagctttcgctgcagtcctcgagaggttctcagaacccctagtcttgagagaggcg
gatgtgggcgagggcctccctgtcaaggttaaggcttcaggaatgtgtgggagagacctg
gtcatatggaggggaggattcaggaacctgacgcctcccctaattctcggccatgagatt
tacggtgagtatgagggaaacccggtgggcgtatacggtgttgagacttgtggggaatgc
aggtactgtagagccgggaaggagaacctatgtgagaacgctagattcctgggagaagct
agacctggaggatacgcggaagtggttacggtgaaagagggtggaatattcccattgccc
gatagggaatacgagaaatacgctgcaggggtatgtccactggcaactgccatacactcc
agcaaggttgcgggggtcaaaaagggagacactgtactcgtgactggggcaggcggagga
gtgggaatacataccatccagtaccttaagtcattgggagctagggtagtatctgttacg
tctccttctaagagcgagatcgtgtccagattttcggaccaggttataacacagaaggac
ttctccaaacaggttaaggatgttgacgtggtcattgagctagtgggttcagaaaccata
aatgagagcttaagagccctaagaagggagggaaccctagtcctagtgggtaacgtgaca
ggaaaggaaatttctctggctagacctgccctcaccatcatgagggagcatagaatagtt
gggtcggcgtcatacacgagggctgaggtagaagaggcggtcaaacttatacatgaggga
gaagtgaagcctgtgtatagaaaatatcacctgagagaagttaatacagcgatgaaggac
ttaatggaagggaaggtgttgggaagggcggtactagttacaggatga

DBGET integrated database retrieval system