KEGG   Metallosphaera sedula: Msed_0464Help
Entry
Msed_0464         CDS       T00509                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
mse  Metallosphaera sedula
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mse00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Msed_0464
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msed_0464
  Lipid metabolism
   00071 Fatty acid degradation
    Msed_0464
  Amino acid metabolism
   00350 Tyrosine metabolism
    Msed_0464
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Msed_0464
   00626 Naphthalene degradation
    Msed_0464
Enzymes [BR:mse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Msed_0464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
419415..420278
Genome map
AA seq 287 aa AA seqDB search
MEEMETKGEFKVRSVGVCGTDVAMVKGSYPPRKDPLVLGHEFAVERDGALYTSEINLVDW
TCKYCRRGMYTHCENRKALGIDVDGAMREYMDLPGYLLHEDRVGLRPEELSLTEPAAAVL
RMVELIHPSPSDRVLVLGDGPVGIISAAVLEHYGFDVELNGHNPERMRVAENLGIPTTRS
STKYDVVVEATGSKALGEAMRYVRHMGKIALKSTHGLEVSLDVTHAVVNEVQLIGSRCGP
FYLWDKAMHLIKELDLRRIVTTYPFSEYERAFQDVLNRKVVKAVLMI
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggaggagatggaaacaaagggagaattcaaggtaagatctgtgggagtgtgcggtacg
gacgttgcaatggttaagggaagctatcctcctaggaaagatccactagtgctgggccat
gaatttgcggtggagagggatggggctctctacacctcggagatcaacttagttgattgg
acttgtaaatactgcagaagggggatgtatacccattgcgagaataggaaggccttggga
attgatgtggatggggccatgagggaatacatggatctgcctggatatctactccacgag
gacagggtgggtcttagacctgaggaactttccttgacggaacctgctgctgccgttctg
agaatggtggaacttattcatccttcaccttccgacagggttcttgtcctgggggacggt
cccgtgggcataatatctgcagcggtccttgagcactacggtttcgacgtggaattgaac
ggacataacccggagaggatgagagttgctgagaatctcgggattcctacgactagatct
tcaaccaagtacgatgtggttgttgaggccacgggtagcaaggcccttggggaagcaatg
agatatgtgagacacatgggaaagatagcccttaagtcaacccacggtctagaagtttcc
ttggacgtaacccacgccgtagtcaatgaggtacagttaatagggagcagatgtggtcct
ttctatctctgggataaggcaatgcaccttatcaaggagctcgatttaaggagaatagtt
accacatatccattctcggaatacgaaagggcctttcaagacgttctaaaccgtaaagtg
gttaaggcggttctcatgatctag

DBGET integrated database retrieval system