KEGG   Metallosphaera sedula: Msed_0497Help
Entry
Msed_0497         CDS       T00509                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mse  Metallosphaera sedula
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mse00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
452297..453229
Genome map
AA seq 310 aa AA seqDB search
MRQIDALKSPRFSQISTFARLPLCGDERVEAVFIGIPFDDATTYRPGARFGPMGIRDGSR
LLRPYNPFQKVYPLDELSACDGGDVDVIPGHIEDTMKRIEEVLVGRMRNSTLFIAGGDHS
ITLPVLRAVHRVHGKVNLVHLDSHYDFWDSHWGKKYDHGTWLRRALEEGLLNEVIQLGIR
GSLFSHEDVEDSKRLGITSYNIREVKANPEKVIREINGLEGPTYISFDIDVVDPAFAPGT
GTPEVGGLTSFEALEILRSLNLNLVGFDVVEVSPPYDVSEITSMLGANLIYEAMSLKARM
KHGEGGKAGN
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagatagatgccctcaaatccccgagattttctcagatttcgacctttgctcga
ttacccctctgcggagacgagagggtcgaggcagttttcataggaattcccttcgatgac
gccacaacctacaggccaggggcaaggttcggtcccatgggtataagggatggttctagg
ttgttgaggccctacaaccccttccagaaggtatatccgcttgacgagctctccgcctgt
gatgggggagacgtggatgtgattccgggtcacattgaggataccatgaagaggattgag
gaggtcctcgtgggaaggatgaggaactcgaccctcttcatagcgggaggggatcactcc
atcaccctaccagtgctgagagcagtgcacagggttcatgggaaggtaaacctggttcac
ctggactcgcattacgacttctgggactcccactggggtaagaaatacgaccacggaacc
tggctcaggagggccctcgaggagggtcttctgaacgaggtaatacagcttgggataagg
ggctccctcttctcccacgaggatgtagaggactccaaaagacttggcataacctcctac
aacattagggaggtgaaggctaacccggagaaggtgatcagggaaattaatggtcttgag
gggcccacttacatctcctttgacatagacgtggtggatccagctttcgcccctgggacc
gggacacctgaagtgggcgggctaacttcgtttgaggcactggagatcctaagatcccta
aacctgaacctggtggggtttgacgtagttgaggtttccccgccctacgacgtgagcgaa
ataacctccatgttgggggcaaacctgatatatgaggccatgagcttgaaggcgaggatg
aagcatggagagggaggtaaagcgggaaattag

DBGET integrated database retrieval system