KEGG   Metallosphaera sedula: Msed_1042Help
Entry
Msed_1042         CDS       T00509                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mse  Metallosphaera sedula
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mse01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mse00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mse00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
968446..971058
Genome map
AA seq 870 aa AA seqDB search
MTDQVKVEIDPLVKERYGVLFGNKNVNGKVVNVEQVIGELTLELRGEIERAMWERRKLLD
SRREVRDKYSFPPMEEKFTHPVTGEVRTFREIVQGLIDNLLDRNTPLRWRLNENLPVPPE
VDPFKVPGLEITGPWNPVDMAIKQINADVSATMGPDDEDAAPPDFIPFGSQEKEVGLYLS
RVNEHMILSGEISEVEITKKGERRKYRINKPRERWPTSIHRVPGMHLLDFHVKVNGKPAP
SIIVDYVIHVLNDFEPLRKRGSLLYFYQPKVQFPEEASIIAKILWKLERILGAEKPGTLI
KMKALYEEGNAGRFLPVIMWYWRFWLVGLNVGRWDYTASLIEMWNQRVLPDPQNGPLMGM
TARHMMAYQRYNAILNIMAGGSPIGGMNAVMLYAENDPYGRARHNPVTLRSMWLDKMRER
LVGLIFVPEGEVESVTLEDILSGKVKGKLYDGYRQSWVASPDERYVSAGNLPLRAPLEKL
QAMLVAPEEWETVDGKRVAPKVSSGLTESERKLFISLGLLNEKGKITPFVLRDMTPEGFL
KLLGGDLWDALYNIPPGEITVENIQHAFYMAANYGFQILNGNLAAAIDDYVLFPGRVVRF
MNDLATYRIFVTWLWTVVQHEPAVTKDGWLKGPKLTEDGVIPADPVIQLKAGERFTKEHF
QKLWELHNQWTRAFFEEYDRLTAIRIVASIISKRTGINVDKLVQAMIRGEAEKLVGHQTE
IGAIPRIREIVSKAYGAYPRYVREISLEEASHKISEIVGNHELVRRELESMQPRFDRSKA
PLIMDVLRRQMLCPNLIQHSGRVLFIIADKDESTREKILEAVYYLDREGRPLFRDMGRPS
RVLLARAVEEGKMPKYALEAHDYVYDIPES
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgacagatcaggtaaaggttgagatagatcccctggttaaggagaggtacggtgttctc
ttcgggaataagaacgttaatggaaaggtagtaaacgttgagcaggtcataggggaacta
accctcgaactgaggggagaaatagagagggccatgtgggaaaggaggaagctactggac
tctcggagagaggttcgagataaatactcattccccccaatggaggagaagttcacacat
ccagtcacgggagaagtgaggacatttcgtgagatagttcagggactcatagacaatctt
ctggacaggaacactcccctcaggtggaggttaaacgaaaacctcccagttcctccggag
gtggatccattcaaggtacctggtctggaaattacgggaccttggaaccccgtggacatg
gccataaagcagataaatgcagacgtttccgcaaccatgggaccagatgacgaggacgcg
gctccgccagacttcattcccttcggttcgcaggagaaggaggtggggctctacctctca
agggtcaacgagcacatgatactatctggggagatctctgaggtcgagataacgaagaag
ggcgaaaggaggaagtataggattaataagcctagggagaggtggcccacgagtattcat
agggttccggggatgcacttactagactttcacgtaaaggtcaacggaaaacctgcgccg
agcataatagttgactacgtgattcacgtccttaatgacttcgagcccttgaggaagagg
ggttcgttactctatttctatcagccaaaggttcagttcccagaggaggcctccataatc
gccaagatactctggaaactcgagaggatcctgggggcagaaaaacctggaaccctgatc
aagatgaaggcgctctacgaggagggtaatgcgggaaggttcctccccgtcatcatgtgg
tattggcgcttctggcttgtgggacttaacgttgggaggtgggactacactgccagcctg
attgagatgtggaaccagagggtcctgcctgatccccagaacggtccgctcatgggaatg
accgcgaggcatatgatggcctatcagaggtataacgccatcctcaacatcatggcaggg
ggatcgcccattggtggaatgaacgcggtcatgctttatgctgagaatgatccctatggg
cgagctagacacaaccctgttaccttgaggtccatgtggttagacaaaatgagggagaga
cttgtgggactaatcttcgtgccggaaggtgaagtggagagcgtgacccttgaggacatc
ctgtcaggaaaggttaaggggaagctctatgacggttataggcagagctgggtagcgtct
ccagacgagaggtacgtgagtgctggcaacttacccctgagggcgcctctggagaagcta
caggccatgctcgttgcccctgaggagtgggagaccgtggatgggaagagggtggcccct
aaggttagcagtggactcaccgagtcggagaggaaactcttcatctccctgggtcttctg
aacgagaaagggaagattacccccttcgtgttgagggatatgacgcctgagggtttccta
aagttgctgggaggagacctttgggatgccctttacaacataccgccaggggagatcacg
gtggagaacattcaacacgcgttctacatggcggcaaactacggcttccaaatactaaat
ggaaacctggccgcggccatcgacgattacgtcctcttccctgggagggtggtgaggttc
atgaacgaccttgcaacctacaggatctttgtgacctggttgtggacagtagtccaacat
gagcccgcagtgaccaaggacggatggctcaagggtccaaaacttacggaggacggagtc
attcctgcggatcccgtgattcagctcaaggccggagagagattcaccaaggagcatttc
cagaaactctgggaactgcacaaccagtggaccagggcattctttgaggagtacgacagg
ctgaccgcaattaggatagttgcctccataatatccaagagaacagggattaacgttgat
aagttggttcaggccatgatcaggggagaggcagagaagttagtgggacatcagaccgag
attggggcgatccccaggattagggagattgtgtccaaggcctatggtgcatatcctaga
tatgtaagggagatctcgctagaggaggcatcccacaagatctcggaaatcgtggggaat
catgagttggtgaggagggaactggagagtatgcaacctagatttgacagatcgaaggca
cccctaataatggatgtcttaaggagacagatgctgtgccccaacttgatacaacacagc
gggagagtcctcttcatcatagctgacaaggacgagagtaccagggagaagatcctcgag
gcagtttactatctggaccgggagggtaggccgttattcagggatatgggtaggccgtca
cgcgtgctattggcgagagcggtagaggaaggtaagatgcccaaatacgcgctagaggcc
catgattatgtatatgatataccggaatcctga

DBGET integrated database retrieval system