KEGG   Metallosphaera sedula: Msed_1201Help
Entry
Msed_1201         CDS       T00509                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mse  Metallosphaera sedula
Pathway
mse00010  Glycolysis / Gluconeogenesis
mse00020  Citrate cycle (TCA cycle)
mse00620  Pyruvate metabolism
mse00633  Nitrotoluene degradation
mse00640  Propanoate metabolism
mse00650  Butanoate metabolism
mse00680  Methane metabolism
mse00720  Carbon fixation pathways in prokaryotes
mse01100  Metabolic pathways
mse01120  Microbial metabolism in diverse environments
mse01130  Biosynthesis of antibiotics
mse01200  Carbon metabolism
Module
mse_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mse_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:mse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msed_1201
   00020 Citrate cycle (TCA cycle)
    Msed_1201
   00620 Pyruvate metabolism
    Msed_1201
   00640 Propanoate metabolism
    Msed_1201
   00650 Butanoate metabolism
    Msed_1201
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Msed_1201
   00680 Methane metabolism
    Msed_1201
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Msed_1201
Enzymes [BR:mse01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Msed_1201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_21 Fer4 Fer4_7 Fer4_16 Fer4_2 Fer4_17 Fer4_9 Fer4_10 Fer4_22 Fer4_8 Fer4_6 Fer4_13 Fer4_4
Motif
Other DBs
NCBI-ProteinID: ABP95362
UniProt: A4YG10
Position
complement(1173850..1174938)
Genome map
AA seq 362 aa AA seqDB search
MGEDVKYVEITYRGIFQKRLAKYIAEGLVYMSRSMGKSAVSFGRYGDSPERNGVPAKYYV
ALGSVSEEDLIGYSTRVEPEYVDVIAVLDDTLLKGVESWAWQGVQPINLKLREGGAMIVT
SRKPMEEVVKLTPSKEFNWTLGKLNWDRSFSGLWAFNDDTTMERVWGAIARVRPDIVDIQ
HVVEYVKSHKKDKLNERLKAVEEAYEGLVTKTMNPGEGVEFKYNPPRLLTWQEMMEGTAI
PAVPRGGRNEQFKRGTTKTERPTVDFDACIKCDLCWVYCPDGCFDKTPEGYYDIAYDYCV
GCGICAEVCPVKNCIVMVDEKRLPDYTRPYSMWKANKAEYKKWLQNARQEVRERPIVPGL
GR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgggagaagatgtaaagtatgtggagataacgtatagggggatatttcagaagaggctg
gccaagtatattgcagaggggttagtgtacatgtcgagatccatggggaagtctgccgtc
tccttcggaaggtatggagactctcctgagaggaacggagtaccagcaaaatactacgtg
gccctgggaagcgtgagcgaggaagatctcataggttattccactagagttgaaccagag
tacgtggacgttatagctgttctagatgatacccttctcaagggagttgagtcttgggca
tggcagggcgttcaaccaatcaatcttaagctcagggagggtggggccatgatagttacc
tcaaggaagcccatggaagaggtcgtgaagctgactccttcaaaggaatttaactggact
ctagggaaactgaactgggacagatcattctcagggttgtgggccttcaacgacgacacc
acaatggaaagggtttggggagccatagccagggtgaggcctgacatagtggatatccag
cacgtggtggagtatgttaagtcgcataagaaggataagttaaacgagaggttgaaggct
gtggaggaggcgtatgaggggctagtcacaaagaccatgaatcctggagaaggtgtggaa
ttcaagtacaatcctcctagactcctaacctggcaagagatgatggaggggacagcaatc
cccgctgttccacgcggaggtagaaacgagcagttcaagaggggaacgacgaaaacggag
agacccacggtggattttgatgcctgcataaagtgcgacctatgctgggtctattgtcct
gacggctgtttcgacaagacgccagagggttattacgacatagcctatgactactgcgtg
ggatgcgggatttgcgcagaggtatgcccagtgaagaactgcatagtcatggtcgatgag
aaaagactaccggactacacaaggccttactccatgtggaaggccaacaaggctgagtac
aagaaatggctccagaacgcgaggcaagaggtaagggaaagaccaattgtaccggggttg
ggaagatga

DBGET integrated database retrieval system