KEGG   Metallosphaera sedula: Msed_1291Help
Entry
Msed_1291         CDS       T00509                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mse  Metallosphaera sedula
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msed_1291
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msed_1291
   00620 Pyruvate metabolism
    Msed_1291
   00640 Propanoate metabolism
    Msed_1291
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Msed_1291
   00680 Methane metabolism
    Msed_1291
Enzymes [BR:mse01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Msed_1291
Lipid biosynthesis proteins [BR:mse01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Msed_1291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1268035..1269690)
Genome map
AA seq 551 aa AA seqDB search
MDYSSAFATALERPDLYWSPFASALRWFKPWNSVLEGGKWFVNGETNIAHNVLSHEGTAL
IWYGEDERREITYSELARLTERVVNVMKDKGVTRGDRVAIYMPNLPETIASLLACAKMGV
VYSVIFAGLGEQAVKARIQDLSPKLVLTTRYTQRRGQRIPLLGGDVTLERNLTPWEDDFT
LPERIEANDPLVIMYTSGTTGRPKGIVLPHGSWMVGHYTVFDIVFSLRPGDVVFTSADVG
WITFSRIMYGTLLHGGTLVFMEGAPDHPRDRVRKIMERENPKVFFTSPTLLRLLRSMDLS
LPRVEYIATAGEIMDEPSWDYAIRFADRVTDIYGQSETGYVVGTPFSLGVESRKGYAGVP
FPGALLETVDENGNRVEGEVGHLVLKSPFPTKFIGVWRNEEKFKEYQRYGGHDTGDLAIV
EGGYVKIVGRSDDMIKVAGHRITSGEVEDVVSKVPGVKDASAVGVPDPVKGEKLVLFIVG
DADPERVKAEVRSKLGPIYVVDRVVRVPRLPKSRSGKVVRRILRDLLTGKDVDPTILEDP
EVVNEVRRSLG
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggattattcctcggcctttgcgacagctctggaaaggccagatctgtactggtcgccc
tttgcctcagcactaagatggtttaagccctggaattcagtcctagagggcgggaagtgg
ttcgtgaacggggagaccaacattgcgcataacgtcctttcacatgagggcacggcacta
atctggtatggtgaagacgagaggagagaaatcacgtactccgagctggccaggctgaca
gagagggtggtcaacgtcatgaaggacaagggagtgactcggggcgatagggtcgcaatc
tacatgccaaaccttcctgaaaccattgcctcactcctcgcctgcgccaagatgggagtc
gtgtactccgttatctttgcaggtcttggggagcaggcagtcaaggccaggattcaggac
ctctcacccaagcttgtgctcaccacgaggtacacccagagaaggggtcagaggattcct
ctcctcggtggtgatgtgacactagaaaggaacctcaccccctgggaagatgacttcact
ctccctgagaggattgaggcaaatgatcccctcgtgataatgtacacctccggtaccaca
ggtagacctaaggggatagttctaccccacggctcctggatggtgggtcactacaccgtg
ttcgatatcgtgttttccctgagacctggtgacgtggtattcacctcagctgacgtggga
tggataacgttttccaggatcatgtatggcactcttcttcatggcggaacactggttttc
atggagggagctcctgatcaccctagggatagggttaggaagatcatggagagggagaac
cccaaggtattcttcacatccccaacgcttctacgcctgttgaggagtatggacctatcc
ctgcctcgcgttgagtacattgccactgcaggcgagataatggatgagccttcctgggat
tacgccataaggttcgccgatagggtcacggatatttacggccaatccgagacaggatat
gtggtggggactccgttctccctgggtgtggagtcaaggaagggatatgccggagttccg
ttccctggagcactgctggaaacagttgatgagaacgggaatagggttgagggtgaggtc
ggccacctagtcctgaagagtcccttccccacgaagttcattggggtctggagaaatgaa
gagaagttcaaggagtatcagaggtacggcggacatgacacgggagacctggcaatcgtg
gaaggcggatacgtcaagattgtgggcaggagtgatgacatgataaaggtcgcaggtcac
aggatcaccagcggagaggtggaggacgtggtttcaaaggttccaggggttaaggacgcg
tctgcggtgggagttcccgaccccgtcaagggggagaaacttgtcctcttcatcgtggga
gacgcagaccctgagagagttaaggcggaggttagatccaaactagggccaatatacgtg
gttgacagggtggtgagagtgcctaggcttcctaagtccaggagcgggaaagtggtgagg
aggatcttgagagacctactcacgggaaaggatgtagacccgacgatactggaggaccct
gaggtggtgaacgaggtcaggagaagtttaggctga

DBGET integrated database retrieval system