KEGG   Metallosphaera sedula: Msed_1353Help
Entry
Msed_1353         CDS       T00509                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mse  Metallosphaera sedula
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msed_1353
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msed_1353
   00620 Pyruvate metabolism
    Msed_1353
   00640 Propanoate metabolism
    Msed_1353
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Msed_1353
   00680 Methane metabolism
    Msed_1353
Enzymes [BR:mse01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Msed_1353
Lipid biosynthesis proteins [BR:mse01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Msed_1353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1323783..1325777
Genome map
AA seq 664 aa AA seqDB search
MSQPENESGLPFQEKVVPELLKHRLVTPEEYLRIHKKTVENYQEYWESVAKELDWFKPWE
KALDDSHPPFYKWFVGGELNASYLAVDRHANSWRRNKVAIIWEGEPWENGPKEVRKLTYL
DLYREVNRAAYLLKEVYGLKKGDTIGIYLPMIPELPIFMLAAARLGVAFTVVFSGFSAQA
VADRMNDADTKLLITADGGWRRGKVIPLKEIVDKALETATTVKNVLVVRRTGTEISMKPG
RDAYLHDVMSKVPIKAYVEPERVKSEDPLYILYTSGTTGKPKGIIHDTGGYMTLLHNTMK
LVFDIRDTDVFWCTADIGWVTGHSYIVFGPLQEGATEVMYEGALDFPEPDRWVSIIERHQ
VSILYTSPTAIRTFMKQGEQWIKKHDVSSVRLMHSVGEPINPEAWRWFHKLVGRGQVPFG
STWWMTETGGIMISHMPGGYLVPMKPGTNGPPLLGIETNVFDEEGKPMPEEQKGYLVITK
PWPGMPLTINKDPERYVKVYWNKFPNVFYAGDYAIKDRDGYFWILGRADEVMKIAGHRIG
TYELESALVQHPAIAEAAVVGVPDPVRGEVAEAFVILRSGVEPSAKLREEIVKFVRENFG
PIAVFREIHFVSKLPKTRSGKIMRRVIKAVATNSPVGDVTTLEDEASVEEVKKAFQELKE
QVGK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaccagaaaatgaatcaggtctaccttttcaagagaaagttgtacctgagtta
ctcaaacacaggttagtgacacctgaggaatacctaagaattcacaagaagaccgtagag
aactaccaagagtactgggaatccgtagctaaggaactggactggttcaagccatgggaa
aaggcgcttgacgattcgcatcctcctttctataagtggtttgttggaggagagctgaac
gcgtcttatcttgcagtggataggcacgccaactcatggaggagaaataaggtagctata
atctgggagggagagccgtgggaaaacggtcccaaggaagtcaggaaattgacgtacctt
gacctataccgtgaggtaaatagggcagcctatctcctcaaggaagtttacggcctaaag
aagggcgataccatagggatttaccttcccatgattccagagcttccaatattcatgctt
gctgccgccagactaggcgtagctttcactgtagtcttctcgggattcagtgcacaggcg
gtagctgataggatgaacgatgccgacaccaagttgcttatcacagctgatggtggttgg
agaagggggaaagtgatacccctcaaggagatcgtggataaggcgcttgagacagccacc
acagtgaagaacgtgttggtggtcaggagaaccggaacagagattagcatgaaacccgga
agagatgcctacttacacgacgtgatgagtaaggttccgattaaggcctacgtggagccg
gagagggtgaaaagtgaggatcctctttacattctttacacctctggcaccacggggaag
cctaagggcataattcacgacacaggcggatacatgactctccttcataacaccatgaaa
cttgtgtttgacattagggatacagacgttttttggtgcaccgcagacataggatgggta
actggtcactcctacatcgtgttcgggccccttcaggaaggagcgactgaggtcatgtac
gagggagccttggacttccctgaacctgacaggtgggtctcgatcatagagagacatcag
gtctcaatactttacacttcacccacggcgataaggacgttcatgaagcagggagagcaa
tggataaagaagcacgacgttagcagcgtaaggctaatgcactcagtgggagagccaatt
aaccctgaggcgtggagatggttccacaaactagtggggagaggacaagttccctttggt
agcacttggtggatgactgaaactggtggaataatgatatcacacatgcctggtggatac
ctagtgcccatgaaacctggaaccaatggtcctcctcttcttggcatagagactaacgta
tttgacgaggaaggaaaacccatgccagaggagcagaagggttacctagtgattaccaag
ccgtggcctggcatgccactcactatcaacaaggatccagaaaggtacgttaaggtatac
tggaacaagtttcccaacgttttctacgccggagattacgcgatcaaggatagggatggt
tacttctggatactggggagagccgacgaggtaatgaagattgccggacacaggattgga
acgtatgagctggagtcggccctcgtgcaacatccagcgatagccgaagcagcagtagtt
ggtgttccagatcctgtcaggggagaggtggctgaggccttcgtcatcctcagatctgga
gtggagcctagcgctaagctaagggaggagattgtgaagttcgtgagagaaaacttcggt
cccatagcggtgttcagggaaatccacttcgtctcgaagctacccaagaccagaagcgga
aagatcatgaggagggtaatcaaggcggttgcaactaactctcccgtgggcgacgtcacc
acgctagaggatgaggcctctgtggaggaggtaaagaaagccttccaggagctcaaggaa
caggtcgggaagtga

DBGET integrated database retrieval system