KEGG   Metallosphaera sedula: Msed_1353Help
Entry
Msed_1353         CDS       T00509                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mse  Metallosphaera sedula
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msed_1353
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msed_1353
   00620 Pyruvate metabolism
    Msed_1353
   00640 Propanoate metabolism
    Msed_1353
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Msed_1353
   00680 Methane metabolism
    Msed_1353
Enzymes [BR:mse01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Msed_1353
Lipid biosynthesis proteins [BR:mse01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Msed_1353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1323783..1325777
Genome map
AA seq 664 aa AA seqDB search
MSQPENESGLPFQEKVVPELLKHRLVTPEEYLRIHKKTVENYQEYWESVAKELDWFKPWE
KALDDSHPPFYKWFVGGELNASYLAVDRHANSWRRNKVAIIWEGEPWENGPKEVRKLTYL
DLYREVNRAAYLLKEVYGLKKGDTIGIYLPMIPELPIFMLAAARLGVAFTVVFSGFSAQA
VADRMNDADTKLLITADGGWRRGKVIPLKEIVDKALETATTVKNVLVVRRTGTEISMKPG
RDAYLHDVMSKVPIKAYVEPERVKSEDPLYILYTSGTTGKPKGIIHDTGGYMTLLHNTMK
LVFDIRDTDVFWCTADIGWVTGHSYIVFGPLQEGATEVMYEGALDFPEPDRWVSIIERHQ
VSILYTSPTAIRTFMKQGEQWIKKHDVSSVRLMHSVGEPINPEAWRWFHKLVGRGQVPFG
STWWMTETGGIMISHMPGGYLVPMKPGTNGPPLLGIETNVFDEEGKPMPEEQKGYLVITK
PWPGMPLTINKDPERYVKVYWNKFPNVFYAGDYAIKDRDGYFWILGRADEVMKIAGHRIG
TYELESALVQHPAIAEAAVVGVPDPVRGEVAEAFVILRSGVEPSAKLREEIVKFVRENFG
PIAVFREIHFVSKLPKTRSGKIMRRVIKAVATNSPVGDVTTLEDEASVEEVKKAFQELKE
QVGK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaccagaaaatgaatcaggtctaccttttcaagagaaagttgtacctgagtta
ctcaaacacaggttagtgacacctgaggaatacctaagaattcacaagaagaccgtagag
aactaccaagagtactgggaatccgtagctaaggaactggactggttcaagccatgggaa
aaggcgcttgacgattcgcatcctcctttctataagtggtttgttggaggagagctgaac
gcgtcttatcttgcagtggataggcacgccaactcatggaggagaaataaggtagctata
atctgggagggagagccgtgggaaaacggtcccaaggaagtcaggaaattgacgtacctt
gacctataccgtgaggtaaatagggcagcctatctcctcaaggaagtttacggcctaaag
aagggcgataccatagggatttaccttcccatgattccagagcttccaatattcatgctt
gctgccgccagactaggcgtagctttcactgtagtcttctcgggattcagtgcacaggcg
gtagctgataggatgaacgatgccgacaccaagttgcttatcacagctgatggtggttgg
agaagggggaaagtgatacccctcaaggagatcgtggataaggcgcttgagacagccacc
acagtgaagaacgtgttggtggtcaggagaaccggaacagagattagcatgaaacccgga
agagatgcctacttacacgacgtgatgagtaaggttccgattaaggcctacgtggagccg
gagagggtgaaaagtgaggatcctctttacattctttacacctctggcaccacggggaag
cctaagggcataattcacgacacaggcggatacatgactctccttcataacaccatgaaa
cttgtgtttgacattagggatacagacgttttttggtgcaccgcagacataggatgggta
actggtcactcctacatcgtgttcgggccccttcaggaaggagcgactgaggtcatgtac
gagggagccttggacttccctgaacctgacaggtgggtctcgatcatagagagacatcag
gtctcaatactttacacttcacccacggcgataaggacgttcatgaagcagggagagcaa
tggataaagaagcacgacgttagcagcgtaaggctaatgcactcagtgggagagccaatt
aaccctgaggcgtggagatggttccacaaactagtggggagaggacaagttccctttggt
agcacttggtggatgactgaaactggtggaataatgatatcacacatgcctggtggatac
ctagtgcccatgaaacctggaaccaatggtcctcctcttcttggcatagagactaacgta
tttgacgaggaaggaaaacccatgccagaggagcagaagggttacctagtgattaccaag
ccgtggcctggcatgccactcactatcaacaaggatccagaaaggtacgttaaggtatac
tggaacaagtttcccaacgttttctacgccggagattacgcgatcaaggatagggatggt
tacttctggatactggggagagccgacgaggtaatgaagattgccggacacaggattgga
acgtatgagctggagtcggccctcgtgcaacatccagcgatagccgaagcagcagtagtt
ggtgttccagatcctgtcaggggagaggtggctgaggccttcgtcatcctcagatctgga
gtggagcctagcgctaagctaagggaggagattgtgaagttcgtgagagaaaacttcggt
cccatagcggtgttcagggaaatccacttcgtctcgaagctacccaagaccagaagcgga
aagatcatgaggagggtaatcaaggcggttgcaactaactctcccgtgggcgacgtcacc
acgctagaggatgaggcctctgtggaggaggtaaagaaagccttccaggagctcaaggaa
caggtcgggaagtga

DBGET integrated database retrieval system