KEGG   Metallosphaera sedula: Msed_1400Help
Entry
Msed_1400         CDS       T00509                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mse  Metallosphaera sedula
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mse00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Msed_1400
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Msed_1400
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Msed_1400
Enzymes [BR:mse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Msed_1400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1372257..1373261
Genome map
AA seq 334 aa AA seqDB search
MRVKCIKCGREREGVEVRCKCGGVFKVEVDVPFSKNLRENFPYVKRWISLGEWNTPSIRV
EGFTYKLDFLNPTGSYKDRGSVTLISHLSQLGIREISEDSSGNAGASIAAYGAMAGMKVK
VFVPSTARGGKLKQIESYGAEVVRVEGTRDDVSRAAENSGAYYASHVLQPEFRDGIRSLA
YEIARDHGWKSPGEVFLPTSAGTLLLGVYEGFRHMVSEGVLDRMPKLVAVQTEQVSPVCS
KFRGIEYRPPSRVTSIADALVSTNPVLMDEMIRVLQETGDCVVVSENEIMDSWKYLSRKG
ILAEYSSAVALAGGRKYEVSDPVIVLTGNGLKTL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagggttaaatgcataaaatgtggaagggagagggaaggcgtagaggttaggtgcaaa
tgcggtggagtcttcaaggtagaggtggacgtcccattttctaaaaatcttagggaaaac
ttcccttacgttaagagatggatttccctaggtgaatggaacaccccgtccattagggtt
gaaggctttacatataagctggatttccttaatcccaccggttcatacaaggatagagga
tcggtaaccctaatttctcacctttctcagcttgggataagggagatctctgaggactca
tctggtaatgcaggcgcctctatagctgcctacggagctatggctgggatgaaggtgaag
gtctttgttccctcaactgcaaggggagggaaactgaaacaaattgaatcttacggggct
gaagtagtcagggtggaaggcacaagagatgacgtatcacgggctgcagagaactctgga
gcctattatgcgtcccacgtccttcaacctgagtttagggacggaataaggtccttagcc
tacgagatagcgagggatcatggatggaaatccccaggagaagtatttttgcccacgtca
gcaggtactctactcctaggagtttatgaagggtttagacacatggtcagcgagggagtc
ctagataggatgcccaagttagttgcagttcaaacggaacaagtgagtccagtatgctcc
aagttccgtggaatagaatatagaccgccaagcagggtcacctccatagctgatgccctt
gtttcaacgaatcccgtactcatggatgaaatgattagggttcttcaagagacgggtgac
tgcgtagttgttagtgaaaatgagatcatggactcttggaaatacctttccaggaaaggg
atacttgccgagtatagctctgcggtggcactagccggaggaaggaaatatgaggtgtca
gaccctgtcatagtgctaacaggcaatggacttaagactttatag

DBGET integrated database retrieval system