KEGG   Metallosphaera sedula: Msed_1422Help
Entry
Msed_1422         CDS       T00509                                 

Definition
coenzyme F390 synthetase-like protein
Orthology
K14466  
4-hydroxybutyryl-CoA synthetase (4-hydroxybutyrate-CoA ligase, AMP-forming) [EC:6.2.1.-]
Organism
mse  Metallosphaera sedula
Pathway
Carbon fixation pathways in prokaryotes
Microbial metabolism in diverse environments
Carbon metabolism
Module
Dicarboxylate-hydroxybutyrate cycle
Hydroxypropionate-hydroxybutylate cycle
Brite
KEGG Orthology (KO) [BR:mse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msed_1422
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Msed_1422
Enzymes [BR:mse01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     Msed_1422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1390852..1392270)
Genome map
AA seq 472 aa AA seqDB search
MTVLQEYERIHEELRREGYINTQYPLNPSETLWNKKIMTMKREELEKVKSFRLKRIVKWA
WDNVPFYRNFWKSKGFEPDQIRDWKDIVKIPILRKDELRKDLSANPPFGSIMVPELAKRI
RFVSATSGSTGLPTFQGWGALELDYFEEAQARYLWTFAGVKPTTVYANYLNMSGFYSWGP
PVVETAMWRCGATAIAGGGETYFSWKARHNLIFRLWKVDVLATTPWLHRLIGEEAKAEGW
ESPFKVLLLHGGAAAENTKKKLFQVHPNAKLAISVWGTTDGHMAVEVPGLDGQLVIWEDM
EIFDIVDPKTDEPASPGERGELIATLLNHFTMPLIRYSLGDYVKNEFTTDPDPTYGITHA
RFVEPIPGRVEWMFKVKGKLLLPIYVEDAVNEIPDTTGMFNVIIYGNEMDKLKIRVETRR
NMVDSTYDSRAREILAERIGLNKDDVEIEWVEPGKTAWTGYKLQVFLDQRKK
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgacggttctacaggaatatgaaaggatccacgaggaacttagaagggaaggttacatt
aacacccaatatcccttgaatccctccgagacgctctggaacaagaagataatgaccatg
aagagggaggagttggagaaggtaaagtccttcaggctcaagaggatagttaagtgggca
tgggacaacgtgcccttttacaggaacttctggaagtccaagggtttcgaaccagatcaa
atacgcgattggaaggatatcgtgaagataccgattctaaggaaggacgaactcaggaag
gacctgtcagctaaccctccattcggttccattatggttcctgagctagccaagaggatt
agatttgtgagtgcaacctctggttccacaggtttacccaccttccaaggttggggtgcc
ctcgaacttgactacttcgaggaggcacaagctaggtatctctggaccttcgccggagtt
aaacctacgactgtttacgcaaactaccttaacatgtcaggtttctacagctggggtcct
ccagtggtcgagactgcaatgtggagatgcggagcgacggctattgcggggggaggtgag
acttacttctcgtggaaggcaaggcataacctcatattcaggctctggaaagtagacgtc
ctggctaccactccctggcttcacaggctcataggagaggaagcaaaggcggagggttgg
gagtccccgttcaaggttcttctccttcacggcggggccgcggccgagaacacgaagaaa
aagttgttccaagttcatcccaacgcgaagctagcgatcagcgtgtggggcacgactgac
ggacacatggccgttgaagtgcctggcctagatggccagcttgtgatttgggaggacatg
gagatatttgatatcgtcgatcccaagaccgacgagccagcatcaccaggagagagggga
gagcttatcgctacccttctcaaccactttaccatgcccctaatcaggtacagtttaggc
gattacgtgaagaatgagtttaccacagatccagatcccacgtatggaataacccacgcc
aggttcgtggagccaattcccggaagagtggaatggatgtttaaggtcaagggcaagtta
ttgctcccaatatacgtggaggatgcagtgaacgagataccagacacaaccggaatgttt
aacgtgataatctacggtaatgagatggataaactgaagataagggttgagacgaggaga
aacatggtagattctacctacgactctagggcaagggagatactcgcagagagaataggg
ctcaacaaggatgatgtggagatagagtgggtggaaccaggtaagactgcctggacaggt
tataagttgcaggtgtttctggaccagagaaagaagtga

DBGET integrated database retrieval system