KEGG   Metallosphaera sedula: Msed_1451Help
Entry
Msed_1451         CDS       T00509                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mse  Metallosphaera sedula
Pathway
mse00010  Glycolysis / Gluconeogenesis
mse00051  Fructose and mannose metabolism
mse00562  Inositol phosphate metabolism
mse01100  Metabolic pathways
mse01110  Biosynthesis of secondary metabolites
mse01120  Microbial metabolism in diverse environments
mse01130  Biosynthesis of antibiotics
mse01200  Carbon metabolism
mse01230  Biosynthesis of amino acids
Module
mse_M00002  Glycolysis, core module involving three-carbon compounds
mse_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msed_1451
   00051 Fructose and mannose metabolism
    Msed_1451
   00562 Inositol phosphate metabolism
    Msed_1451
Enzymes [BR:mse01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Msed_1451
Exosome [BR:mse04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Msed_1451
  Exosomal proteins of bladder cancer cells
   Msed_1451
  Exosomal proteins of melanoma cells
   Msed_1451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG NMO His_biosynth Glu_synthase DUF561 FMN_dh
Motif
Other DBs
NCBI-ProteinID: ABP95608
UniProt: A4YGQ6
Position
complement(1417539..1418225)
Genome map
AA seq 228 aa AA seqDB search
MKVPIILVNFKVYETSYGRRGLEMAKIVEKVALETSTEIIIAVPATMITRVAESVTIPVY
AQHVDGVPEGAHTGAVTPELIKDAGAKGSLLNHSERRVRMDEMDDALKRMKKLGLESVIC
VDRYELVAPMALLKPTAVLVEPPELIGTGVSVSKARPEVITSAVDEIRKVQGVYLIAGAG
ITSGEDVYVAMKLGSDGVGAASAIMKAKEPQKVLLDFVNGAIRALEER
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttccaatcatccttgtgaactttaaggtctacgaaacctcttacggcagaaga
ggtctggaaatggccaagattgttgagaaggttgcactggagacgtcaactgagataatc
attgcggtcccagccactatgataactagagtggccgagtcggtcacaatacccgtatat
gcccagcatgtggatggggttcccgaaggtgcccatacgggagcggtgacgccagagctg
ataaaggacgctggggccaagggaagcttactaaatcatagtgaaaggagggtaaggatg
gacgagatggacgacgccctaaagaggatgaaaaagttgggtctagaatcagtgatctgc
gtggatagatatgaactggttgctcccatggctcttcttaaacccacagcagttttggtg
gaaccacccgagttaataggcacgggcgtgtctgtgtccaaggctagaccagaggtcata
acgagcgcagtggacgagataagaaaggtgcagggagtttacctcattgcgggcgcaggt
atcacttcaggtgaggatgtatatgttgcaatgaagttgggctctgatggagttggagct
gccagtgccatcatgaaggcaaaggaaccccaaaaggttctccttgatttcgtaaatggg
gcaataagggcgcttgaggaaagataa

DBGET integrated database retrieval system