KEGG   Metallosphaera sedula: Msed_1451Help
Entry
Msed_1451         CDS       T00509                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mse  Metallosphaera sedula
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:mse01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mse01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mse00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mse00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:mse00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1417539..1418225)
Genome map
AA seq 228 aa AA seqDB search
MKVPIILVNFKVYETSYGRRGLEMAKIVEKVALETSTEIIIAVPATMITRVAESVTIPVY
AQHVDGVPEGAHTGAVTPELIKDAGAKGSLLNHSERRVRMDEMDDALKRMKKLGLESVIC
VDRYELVAPMALLKPTAVLVEPPELIGTGVSVSKARPEVITSAVDEIRKVQGVYLIAGAG
ITSGEDVYVAMKLGSDGVGAASAIMKAKEPQKVLLDFVNGAIRALEER
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttccaatcatccttgtgaactttaaggtctacgaaacctcttacggcagaaga
ggtctggaaatggccaagattgttgagaaggttgcactggagacgtcaactgagataatc
attgcggtcccagccactatgataactagagtggccgagtcggtcacaatacccgtatat
gcccagcatgtggatggggttcccgaaggtgcccatacgggagcggtgacgccagagctg
ataaaggacgctggggccaagggaagcttactaaatcatagtgaaaggagggtaaggatg
gacgagatggacgacgccctaaagaggatgaaaaagttgggtctagaatcagtgatctgc
gtggatagatatgaactggttgctcccatggctcttcttaaacccacagcagttttggtg
gaaccacccgagttaataggcacgggcgtgtctgtgtccaaggctagaccagaggtcata
acgagcgcagtggacgagataagaaaggtgcagggagtttacctcattgcgggcgcaggt
atcacttcaggtgaggatgtatatgttgcaatgaagttgggctctgatggagttggagct
gccagtgccatcatgaaggcaaaggaaccccaaaaggttctccttgatttcgtaaatggg
gcaataagggcgcttgaggaaagataa

DBGET integrated database retrieval system