KEGG   Metallosphaera sedula: Msed_1582Help
Entry
Msed_1582         CDS       T00509                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mse  Metallosphaera sedula
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:mse00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Msed_1582
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Msed_1582
   00640 Propanoate metabolism
    Msed_1582
   00660 C5-Branched dibasic acid metabolism
    Msed_1582
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Msed_1582
Enzymes [BR:mse01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Msed_1582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1530193..1531206)
Genome map
AA seq 337 aa AA seqDB search
MKLYEYEGKRLFSLVNIPVPRGQVVKSPVHVQGKVVVKSQLLEGGRGKRGLVRVTEDSYG
TIQELMKEGINTFLIEEFVPHTREIYLSAMMDRETGNPMIVASPFGGINIEESKDVKTFV
IPIDRKLMRYDVDAIEKYVGYRGLGGVIEGLLRLILEYDAELAEINPLAITENGPLALDS
KVILDDNALYRHEELLKELQREKVPADSYVELEGDVGIVGNGAGLTMATMDLVKLMGGNP
ADFLDVGGGADTEKVASAVIRVGSNPKVKKIVINIFGGITRCDEVAKGIVEAYRKINKPI
YVRLTGTNEDEGKKILQSQGIRVYEDALTAIGDALRS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttacgagtatgagggaaagaggcttttttcgctcgttaacatcccagtgcct
cgcggacaggtggtgaagtcccctgttcacgttcaagggaaggtggtggttaagtcacaa
ctacttgagggcggtaggggaaagagggggcttgttagggtaactgaggacagttacggc
acgattcaagaactcatgaaggaaggtataaacacattcttgatagaggaatttgtcccg
cacaccagggaaatatacctttcagctatgatggatcgagagactgggaacccgatgata
gtggcatccccatttggtgggataaacattgaggagagtaaggacgtcaagacttttgtt
atccccatagatagaaaattaatgaggtacgatgtggatgcaatcgagaaatatgttggg
tataggggtctcggaggggtcatagaaggtttactcaggctaatcttggagtacgacgct
gaattggctgagattaatccgctcgccatcacggagaacggtcctctggctctcgactcc
aaggtaatcctagatgataacgcactgtatagacacgaagaactgttaaaggagctacag
agggagaaagttccagcggattcctacgtcgaactcgagggagacgtgggcatagtgggt
aatggcgcaggtcttacaatggcgaccatggatctcgtgaaactaatggggggaaatccg
gctgatttcctagatgtaggagggggtgcagataccgaaaaggttgcgtctgcggtgatc
agggttggaagtaaccccaaggtgaaaaagatagtgattaacattttcggtggaataact
aggtgtgatgaggtagctaaggggatagtggaggcctatcgtaagataaacaaacccatt
tacgtcaggttaactggtacgaatgaggatgaagggaagaaaatactccaaagtcaaggg
ataagagtttacgaagatgcattaaccgcaataggtgatgccctacgttcataa

DBGET integrated database retrieval system