KEGG   Metallosphaera sedula: Msed_1652Help
Entry
Msed_1652         CDS       T00509                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mse  Metallosphaera sedula
Pathway
mse00010  Glycolysis / Gluconeogenesis
mse01100  Metabolic pathways
mse01110  Biosynthesis of secondary metabolites
mse01120  Microbial metabolism in diverse environments
mse01130  Biosynthesis of antibiotics
mse01200  Carbon metabolism
mse01230  Biosynthesis of amino acids
Module
mse_M00002  Glycolysis, core module involving three-carbon compounds
mse_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mse00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msed_1652
Enzymes [BR:mse01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Msed_1652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N Sacchrp_dh_NADP GFO_IDH_MocA 2-Hacid_dh_C NAD_binding_3 Semialdhyde_dh F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ABP95807
UniProt: A4YHA5
Position
complement(1593642..1594664)
Genome map
AA seq 340 aa AA seqDB search
MIKVAVNGYGTIGKRVASAILAQPDMTLVGVSKTSPNYEAYQAQKMGINLYVTKESLKEF
EEAGIKVKGVLEDMIKEADVVVDATPNGVGAQYKQVYSSMGKRALFQGGEKANVADVSFS
ALCNYDEAVDKRYVRVVSCNTTGLLRTLCTLNRVSKIAKVRGTIVRRAADPKEVKKGPIN
SLVPDPASIPSHHAKDVNTVLKDLDIVTMAVVAPTTLMHVHLLDVTVSSPVTKEDVLSVL
SSTPRILLASGKSKVSSTAEIVEVARDMGRPRNDLYELVVFEDSVSVRGNEVFLMYAVHQ
ESIVVPENVDAIRAVSGFADGRKSIEMTNASMGIGKGYLV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggtagcagttaacggttacggaaccattggtaagagggtcgcgagtgcgatc
cttgcacaacctgacatgaccttggtaggggtatctaagacctcgcccaactacgaagca
tatcaggcccagaagatggggataaacctctacgtaactaaggagtcgctgaaggagttt
gaggaggcagggatcaaggtaaagggagtcctggaggacatgatcaaggaagctgacgtt
gtggtggacgccactccaaacggcgttggtgcccaatataagcaggtttactcgtccatg
ggtaagagggcactatttcagggaggagagaaggccaatgtggctgacgtttccttctca
gctctttgcaactatgacgaggcagtggataagcggtacgtaagagtcgtgtcctgtaat
accactgggctattgaggacgctgtgcaccctgaacagggtaagcaagattgcgaaagtc
aggggaaccatagtgaggagagctgctgacccaaaggaagtgaagaagggacccatcaat
tcccttgtacctgatccagcctcgatcccaagccatcatgcgaaggacgttaatacagtg
ctcaaggacctggacattgtaaccatggcagtggtggctcccacgacactgatgcacgtt
caccttctagacgtcacggtaagtagcccagttactaaggaggacgtcctctcggtgctc
agctcaacccccaggatacttctggcatctgggaaatctaaggtgtcctctaccgctgag
atagttgaagttgccagggacatggggagacccagaaatgacctatatgagctggtggtc
ttcgaggactccgtctcagtcaggggaaacgaggtcttcttaatgtacgcagttcaccag
gaatctatcgttgtccctgagaacgtggacgcaatcagggcggtctcaggtttcgcagac
ggaaggaagtcaattgagatgaccaacgcctccatgggaattggaaagggatacctggtg
tga

DBGET integrated database retrieval system