KEGG   Metallosphaera sedula: Msed_1691Help
Entry
Msed_1691         CDS       T00509                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mse  Metallosphaera sedula
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mse00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Msed_1691
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Msed_1691
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Msed_1691
Enzymes [BR:mse01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Msed_1691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1629255..1630529)
Genome map
AA seq 424 aa AA seqDB search
MANSEEIIPSYWYNIIPDLPKPLPPPRDPPDAEFSRIDLLRKIMPSEVLRQQFTVERFVP
IPKEVREAYINIGRPTPLVRARRLEEFLNTPAKIYFKYEGATPTGSHKINTALPQAYFSM
KEGVDHLVTETGAGQWGTAVALSARMYGLNSTIFMVKVSYEQKPQRRTIMQLYGARVFAS
PTSHTEYGKKVLNENPNHPGSLGIAMSEAIEYALSNGYKYLVGSVLDVVVLHQSVIGLEA
MKQLQELDEEPDVLVGCVGGGSNFGGFTFPFIGSKKGSKYIAVGSYEIPKFSKGAYNYDF
PDSAGLLPLVKMITLGRDYVPPPIYSGGLRYHGAAPSLSMLIKEGIVDWREYNEKEIFEA
AQIFLQTQGIVPAPESSHAIRAVIEEAREAKIKNEKKVIVFNLSGHGLLDLPNYESMMKR
IGQD
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatagtgaggaaataataccaagctattggtataacataatacccgatttaccc
aaacctttacctcctcctagggatcccccagacgcggagttctctaggattgaccttttg
agaaaaataatgcccagtgaggttctaagacagcagtttacagtggagaggtttgttcca
attcctaaagaagtaagggaggcttacatcaatataggcagacctacgcctttagtcaga
gctagaaggcttgaggaattcctgaacactccggctaaaatatatttcaagtatgaaggg
gcaactcccactggttcccataagataaacacagccctaccgcaggcttacttttccatg
aaggagggagtggaccacctggtcactgagactggggctggccaatggggaacagctgta
gctctatctgcgagaatgtatggactaaattccaccattttcatggtaaaggtgagttac
gaacagaaaccgcaaaggagaaccatcatgcaattgtatggcgcacgagttttcgccagc
cctacctcgcataccgagtacggcaagaaggttctaaacgagaacccgaatcatccaggt
tccctcggaatagccatgagcgaggcaatagagtacgctctctccaacggctataagtat
ctcgtcgggagcgtgttagatgttgtggtgttacatcaaagcgtaatagggcttgaggct
atgaagcagttgcaggaactagacgaggaaccagacgtgttagtgggctgtgtgggagga
gggagtaactttggaggctttaccttcccgttcatcgggtccaagaagggatcgaagtac
attgcagttggatcttacgagataccaaagttcagtaagggggcctataactacgatttc
ccagacagtgctgggctgttaccccttgtcaagatgattaccctaggaagggattacgta
cctccaccaatatattcgggtgggctcagatatcacggggccgcgccctccctaagtatg
ttgatcaaggaagggatagtggattggagggagtacaatgagaaggagatattcgaagca
gctcaaatattccttcaaacccaaggaatagttccagcaccagaatcctctcatgcaatt
agggcagtgatagaggaggcacgcgaggccaagatcaagaacgagaaaaaggtgatcgta
ttcaacctgagtggtcatggattactggatctacctaactacgagtctatgatgaagagg
attggtcaagattga

DBGET integrated database retrieval system