KEGG   Metallosphaera sedula: Msed_1811Help
Entry
Msed_1811         CDS       T00509                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mse  Metallosphaera sedula
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mse00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Msed_1811
   00052 Galactose metabolism
    Msed_1811
   00500 Starch and sucrose metabolism
    Msed_1811
   00520 Amino sugar and nucleotide sugar metabolism
    Msed_1811
Enzymes [BR:mse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Msed_1811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1753539..1754306
Genome map
AA seq 255 aa AA seqDB search
MQAVITAAGLGTRMLPASKEIPKEMFPVPFRGSFKPIIQVIFEQLYDAGVRDFVIVVGRG
KRVIEDHFTPDQDFVYYLEKMGKSRQAKDLNAFYEKIEKSNIAFVNQASPEGFGDAVLRA
KPFIKSDFLVSAADTILEEIPRMEVNSFLVTQVDDPKPYGVVLLDGELVVDVEEKPREPK
SNWVIAPYYHFDYMIFEALEKTKRSGKELQLTDAIKYLMNNGVAFRAVKVAKMYDLGNVE
NYISSLRAILLRGDI
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccgtaattaccgcggctggtctcggaacccggatgcttcctgcctccaaggag
atcccaaaggagatgtttccagttcccttcaggggctcgttcaagcccataatccaggtt
atattcgagcagttatatgacgctggcgttagggatttcgtcattgttgtgggaagggga
aaaagggtaattgaggatcactttactcccgatcaggactttgtgtattacctcgagaag
atgggtaagagcaggcaagccaaggacctgaacgcgttttatgagaaaatcgagaaaagt
aatatagcctttgtgaatcaggcttcacctgaaggcttcggagacgcggtattgagggct
aaacctttcatcaagtcggacttcttggtttcagctgctgataccatactcgaggagatc
cccaggatggaggttaactcctttctggtgacccaagttgacgaccctaagccttatggg
gttgtcttactggacggggaactagtcgtagatgttgaggagaagcctagggaacccaaa
tcgaactgggtcatagctccatattaccactttgattacatgattttcgaggcacttgag
aaaaccaagagaagtggaaaggagttacagctcacagacgcaatcaaatacctgatgaat
aatggggtagcctttcgtgcagtgaaagttgccaagatgtatgaccttggtaacgtcgag
aattacatctcatcattgagggctatactgttgcgaggggatatatag

DBGET integrated database retrieval system