KEGG   Metallosphaera sedula: Msed_1811Help
Entry
Msed_1811         CDS       T00509                                 

Definition
(RefSeq) UDP-glucose pyrophosphorylase (EC:2.7.7.9)
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mse  Metallosphaera sedula
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mse00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Msed_1811
   00052 Galactose metabolism
    Msed_1811
   00500 Starch and sucrose metabolism
    Msed_1811
   00520 Amino sugar and nucleotide sugar metabolism
    Msed_1811
Enzymes [BR:mse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Msed_1811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1753539..1754306
Genome map
AA seq 255 aa AA seqDB search
MQAVITAAGLGTRMLPASKEIPKEMFPVPFRGSFKPIIQVIFEQLYDAGVRDFVIVVGRG
KRVIEDHFTPDQDFVYYLEKMGKSRQAKDLNAFYEKIEKSNIAFVNQASPEGFGDAVLRA
KPFIKSDFLVSAADTILEEIPRMEVNSFLVTQVDDPKPYGVVLLDGELVVDVEEKPREPK
SNWVIAPYYHFDYMIFEALEKTKRSGKELQLTDAIKYLMNNGVAFRAVKVAKMYDLGNVE
NYISSLRAILLRGDI
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccgtaattaccgcggctggtctcggaacccggatgcttcctgcctccaaggag
atcccaaaggagatgtttccagttcccttcaggggctcgttcaagcccataatccaggtt
atattcgagcagttatatgacgctggcgttagggatttcgtcattgttgtgggaagggga
aaaagggtaattgaggatcactttactcccgatcaggactttgtgtattacctcgagaag
atgggtaagagcaggcaagccaaggacctgaacgcgttttatgagaaaatcgagaaaagt
aatatagcctttgtgaatcaggcttcacctgaaggcttcggagacgcggtattgagggct
aaacctttcatcaagtcggacttcttggtttcagctgctgataccatactcgaggagatc
cccaggatggaggttaactcctttctggtgacccaagttgacgaccctaagccttatggg
gttgtcttactggacggggaactagtcgtagatgttgaggagaagcctagggaacccaaa
tcgaactgggtcatagctccatattaccactttgattacatgattttcgaggcacttgag
aaaaccaagagaagtggaaaggagttacagctcacagacgcaatcaaatacctgatgaat
aatggggtagcctttcgtgcagtgaaagttgccaagatgtatgaccttggtaacgtcgag
aattacatctcatcattgagggctatactgttgcgaggggatatatag

DBGET integrated database retrieval system